KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_3369Help
Entry
EC042_3369        CDS       T02067                                 

Gene name
ebgA
Definition
evolved beta-galactosidase subunit alpha (EC:3.2.1.23)
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EC042_3369 (ebgA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EC042_3369 (ebgA)
Enzymes [BR:elo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     EC042_3369 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3593647..3596739
Genome map
AA seq 1030 aa AA seqDB search
MNRWENIQLTHENRLAPRAYFFSYDSVAQARTFARETSSLFLPLSGQWNFHFFDHPLQVP
EAFTSELMADWGHITVPAMWQMEGHGKLQYTDEGFPFPIDVPFVPSDNPTGAYQRIFTLS
DGWQGKQTLIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFDISAMVKTGDNLLCVRVMQW
ADSTYVEDQDMWWSAGIFRDVYLIGKQLTHINDFTVRTDFDEAYCDATLSCEVVLENLAA
SPVATTLEYSLFDGERVVHSSSIDHLAIEKLTSASFAFTVEQPQQWSAESPYLYHLVMTL
KDADGNILEVVPQRVGFRDIKVRDGLFWINNRYVMLHGVNRHDNDHRKGRAVGMDRVEKD
LQLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVESHGFANVGDISRITDDPQW
ENVYVERIVRHIHAQKNHPSIIIWSLGNESGYGCNIRAMYHAAKALDDTRLVHYEEDRDA
EVVDIISTMYTRVPLMNEFGEYPHPKPRIICEYAHAMGNGPGGLTEYQNVFYKHDCIQGH
YVWEWCDHGIQAQDDNGNVWYKFGGDYGDYPNNYNFCLDGLIYSDQTPGPGLKEYKQVIA
PVKIHALDLTRGELKVENKLWFTTLDDYTLHAEVRAEGETLATQQIKLRDVAPNSEAPLQ
ITLPQLDAREAFLNITVTKDSRTRYSEAGHSIATYQFPLKENTAQPVPFAPNNARPLTLE
DDRLSCTVRGYNFAITFSKTSGKPTSWQVNGESLLTREPKINFFKPMIDNHKQEYEGLWQ
PNHLQIMQEHLRDFVVEQSDDEVLIISRTVIAPPVFDFGMRCTYIWRIAADGQVNVALSG
ERYGDYPHIIPCIGFTMGINGEYDQVAYYGRGPGENYADSQQANIIEIWRSTVDAMFENY
PFPQNNGNRQHVRWTALTNRHGNGLLVVPQRPINFSAWRYTQENIHAAQHCNELQRSDDI
TLNLDHQLLGLGSNSWGSEVLDSWRVWFRDFSYGFTLLPVSGGEATAQSLASYEFGAGFF
STNLHSENKQ
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctgggaaaacattcagctcacccacgaaaaccgacttgcgccgcgtgcgtac
tttttttcatatgattctgttgcgcaagcgcgtacctttgcccgcgaaaccagcagcctg
tttctgcccttaagcggtcagtggaatttccacttttttgaccacccgctgcaagtgcca
gaagccttcacctctgagttaatggctgactgggggcatattaccgtccccgccatgtgg
caaatggaaggtcacggcaaactgcaatataccgacgaaggttttccgttccctatcgat
gtgccgtttgtccccagcgataacccaaccggtgcctatcaacgtattttcaccctcagc
gacggctggcagggtaaacagacgctgattaaatttgacggcgtcgaaacctattttgaa
gtctacgttaacggtcagtatgtgggtttcagcaagggcagtcgcctgaccgcagagttt
gacatcagcgcgatggttaaaaccggcgacaacctgttgtgtgtgcgcgtgatgcaatgg
gcggactctacctacgtggaagaccaggatatgtggtggtcagcggggatcttccgcgat
gtttatctgatcggaaaacaactaacacatattaacgatttcaccgttcgtaccgacttt
gacgaagcctattgcgatgccacgctttcctgcgaagtggtgctggaaaatctcgccgcc
tcccctgtcgcaacgacgctggaatatagcctgttcgacggcgagcgtgtggtgcacagc
agctccattgatcatctggcaattgaaaaactgaccagcgccagctttgcgtttactgtc
gaacagccgcagcaatggtcggcagagtctccttatctttaccatctggtcatgacgctg
aaagacgccgacggcaacattctggaagtggtgccgcaacgcgttggctttcgtgatatc
aaagtgcgcgacggtctgttctggatcaataaccgttatgtgatgctgcacggcgtcaac
cgccacgacaacgatcatcgcaaaggccgcgccgttgggatggatcgcgtcgagaaagat
ctccagttgatgaagcagcacaacatcaactccgtacgtaccgctcactacccgaacgat
ccgcgtttttacgaactgtgtgatatctacggcctgtttgtgatggcggaaaccgacgtc
gaatcgcacggctttgccaatgtcggcgatatcagccgtattaccgacgatccgcagtgg
gaaaacgtctacgtcgagcgcattgttcgccatattcacgcgcagaaaaaccatccgtcg
atcatcatctggtcgctgggcaatgaatccggctatggctgtaacatccgcgcgatgtac
cacgcggcgaaggcgctggatgacacgcgactggtgcactacgaagaagatcgcgatgct
gaagtggtcgatattatttccaccatgtacacccgcgtgccgctgatgaatgagtttggt
gaatacccgcatccgaagccgcgcatcatctgtgaatatgctcatgcgatgggaaacgga
ccgggcgggctgacggagtaccagaacgtcttctataagcacgattgcattcagggacat
tatgtctgggaatggtgcgaccacgggatccaggcgcaggatgacaacggcaatgtctgg
tataaattcggcggcgactacggcgactatcccaacaactataacttctgtcttgatggt
ttgatctattccgatcagacgcctgggccgggcctgaaagagtacaaacaggttatcgcg
ccggtaaaaatccacgcgttggatctgactcgcggcgagttgaaagtcgaaaataaactg
tggtttaccacgctggatgactacaccctgcacgcagaggtgcgcgccgaaggtgaaaca
ctcgcgacgcagcagattaaactgcgcgacgttgcgccgaacagcgaagcccccttacag
atcacgctgccgcagctggacgcccgcgaagcgttcctcaacattacggtgaccaaagat
tcccgcacccgctacagcgaagccgggcattctatcgccacttatcagttcccgctgaag
gaaaacaccgcgcagcctgtacctttcgcaccgaataacgcccgtccgctgacgctggaa
gacgatcgtttgagctgtactgttcgcggctacaactttgcgatcaccttctcaaaaacg
agtggtaaaccgacatcctggcaggtaaatggcgaatcgctgctgacccgcgagccaaag
atcaacttcttcaagccgatgatcgacaaccataagcaggagtacgaagggctgtggcag
ccaaatcatttgcagatcatgcaggagcatctgcgcgattttgtcgttgagcaaagtgat
gatgaagtgttgatcatcagccgcacggttattgccccaccggtgtttgatttcggaatg
cgctgcacctacatctggcgcatcgctgccgatggccaggttaacgtggcgctttccggc
gagcgttacggcgactatccgcacatcattccgtgcatcggtttcaccatggggattaac
ggcgaatacgaccaggtggcgtattacggtcgtggaccgggcgaaaactacgccgacagc
cagcaggctaacatcatcgaaatctggcgcagcaccgtcgatgccatgttcgagaactat
cccttcccgcagaacaacggcaaccgtcagcatgtccgctggacggcactcactaaccgc
cacggcaacggtctgctggtggttccacagcgccccattaacttcagcgcctggcgctat
acccaggaaaacatccacgctgcccagcactgtaacgagcttcagcgcagtgatgacatc
actctgaatctcgaccaccagctgcttggcctcggctccaactcctggggcagcgaggtg
ctggactcctggcgcgtctggttccgtgacttcagctacggctttacgttgctgccggtt
tctggcggagaagctaccgcgcaaagcctggcgtcgtatgagttcggcgcagggttcttt
tccacgaatttgcacagcgagaataagcaatga

DBGET integrated database retrieval system