KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_3479Help
Entry
EC042_3479        CDS       T02067                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine L-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:elo00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:elo00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3704072..3705331)
Genome map
AA seq 419 aa AA seqDB search
MDKFRVQGPTKLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDVDTSMKLLSQL
GAKVERNGSVHIDARDVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCTIGAR
PVDLHISGLEQLGATIKLEEGYVKASVDGRLKGAHIVMDKVSVGATVTIMCAATLAEGTT
IIENAAREPEIVDTANFLITLGAKISGQGTDRIVIEGVERLGGGVYRVLPDRIETGTFLV
AAAISRGKIICRNAQPDTLDAVLAKLRDAGADIEVGEDWISLDMHGKRPKAVNVRTAPHP
AFPTDMQAQFTLLNLVAEGTGFITETVFENRFMHVPELSRMGAHAEIESNTVICHGVEKL
SGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttcgtgttcaggggccaacgaagctccagggcgaagtcacaatttccggc
gctaaaaatgctgctctgcctatcctttttgccgcactactggcggaagaaccggtagag
atccagaacgtcccgaaactaaaagacgtcgatacatcaatgaagctgctaagccagctg
ggtgcgaaagtagaacgtaatggttctgtgcatattgatgcccgcgacgttaatgtattc
tgcgcaccttacgatctggttaaaaccatgcgtgcttctatctgggcgctggggccgctg
gtagcgcgctttggtcaggggcaagtttcactgcctggcggttgtacgatcggtgcacgt
ccggttgatctacacatttctggcctcgaacaattaggcgcgaccatcaaactggaagaa
ggttacgttaaagcttccgtcgatggtcgtctgaaaggcgcacatatcgtgatggataaa
gtcagcgttggcgcaacggtgaccatcatgtgtgctgcaaccctggcggaaggtaccacg
attattgaaaacgcagcgcgtgaaccggaaatcgtcgataccgcgaacttcctgattacg
ctgggtgcgaaaattagcggtcagggcaccgatcgtatcgtcatcgaaggtgtggaacgt
ttaggcggcggtgtctatcgcgtgctgccggatcgtatcgaaaccggtactttcctggtg
gcggcggcgatctctcgcggcaaaattatctgccgtaacgcgcagccagatactctggac
gccgtgctggcgaaactgcgtgacgctggagcggacatcgaagtcggcgaagactggatt
agcctggatatgcatggcaaacgtccgaaggctgttaacgtacgtaccgcgccgcatccg
gcattcccgaccgatatgcaggcccagttcacgctgttgaacctggtggcagaagggacc
ggcttcatcaccgaaacggtctttgaaaaccgctttatgcatgtgccagagctgagccgt
atgggcgcgcacgccgaaatcgaaagcaataccgttatttgtcacggtgttgaaaaactt
tctggcgcacaggttatggcaaccgatctgcgtgcatcagcaagcctggtgctggctggc
tgtattgcggaagggacgacggtagttgatcgtatttatcacatcgatcgtggctacgaa
cgcattgaagacaaactgcgcgctttaggtgcaaatattgagcgtgtgaaaggcgagtaa

DBGET integrated database retrieval system