KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4293Help
Entry
EC042_4293        CDS       T02067                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00010  Glycolysis / Gluconeogenesis
elo00051  Fructose and mannose metabolism
elo00562  Inositol phosphate metabolism
elo01100  Metabolic pathways
elo01110  Biosynthesis of secondary metabolites
elo01120  Microbial metabolism in diverse environments
elo01130  Biosynthesis of antibiotics
elo01200  Carbon metabolism
elo01230  Biosynthesis of amino acids
Module
elo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
elo_M00002  Glycolysis, core module involving three-carbon compounds
elo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EC042_4293 (tpiA)
   00051 Fructose and mannose metabolism
    EC042_4293 (tpiA)
   00562 Inositol phosphate metabolism
    EC042_4293 (tpiA)
Enzymes [BR:elo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EC042_4293 (tpiA)
Exosome [BR:elo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EC042_4293 (tpiA)
  Exosomal proteins of bladder cancer cells
   EC042_4293 (tpiA)
  Exosomal proteins of melanoma cells
   EC042_4293 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBG37118
UniProt: D3GRX5
Structure
PDB: 

Jmol
Position
complement(4583000..4583767)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgcgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacctctgct
gctatgctgaaagacatcggcgcacagtacatcatcatcggccactctgaacgtcgtact
taccacaaagagtctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggt
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaacgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcggtactgaaaactcagggtgctgcagcattcgaa
ggtgcggtaatcgcttacgaaccagtatgggcaatcggtactggcaaatctgcaactccg
gcgcaggcacaggctgttcacaaattcatccgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcatccagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccagacatcgacggcgcgctggttggcggtgcttctctgaaagctgac
gctttcgcagtgatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system