KEGG   Escherichia coli P12b: P12B_c0077Help
Entry
P12B_c0077        CDS       T02030                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
elp  Escherichia coli P12b
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:elp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    P12B_c0077 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    P12B_c0077 (murE)
Enzymes [BR:elp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     P12B_c0077 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
91765..93180
Genome map
AA seq 471 aa AA seqDB search
MTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGVAAIIAEAKDEATDGEIREMHGVPV
IYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGETSAVMGTV
GNGLLGKVIPTENTTGSAVDVQHELAGLVDQGATFCAMEVSSHGLVQHRVAALKFAASVF
TNLSRDHLDYHGDMEHYEAAKWLLYSEHHCGQAIINADDEVGRRWLAKLPDAVAVSMEDH
INPNCHGRWLKAIDVNYHDSGATIRFSSSWGDGEIESHLMGAFNVSNLLLALATLLALGY
PLADLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVF
GCGGDRDKGKRPLMGAIAEEFADVAVVTDDNPRTEEPRAIINDILAGMLDAGHAKVMEGR
AEAVTCAVMQAKENDVVLVAGKGHEDYQIVGNQRLDYSDRVTVARLLGVIA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgacagccgtgtggctgcggcgggcgatctctttgtagctgtagtaggtcat
caggcggacgggcgtcgatatatcccgcaggcgatagcgcaaggtgtggctgccattatt
gcagaggcgaaagatgaggcgaccgatggtgaaatccgtgaaatgcacggcgtaccggtc
atctatctcagccagctcaacgagcgtttatctgcactggcgggccgcttttaccatgaa
ccctctgacaatttacgtctcgtgggcgtaacgggcaccaacggcaaaaccacgactacc
cagctgttggcgcagtggagccaactgcttggcgaaaccagcgcggtaatgggcaccgtt
ggtaacggcctgctggggaaagtgatcccgacagaaaatacaaccggttcggcagtcgat
gttcagcatgagctggcggggctggtggatcagggcgcgacgttttgcgcaatggaagtt
tcctcccacgggctggtacagcaccgtgtggcggcattgaaatttgcggcgtcggtcttt
accaacttaagccgcgatcaccttgattatcatggtgatatggaacactacgaagccgcg
aaatggctgctttattctgagcatcattgcggtcaggcgattattaacgccgacgatgaa
gtgggccgccgctggctggcaaaactgccggacgcggttgcggtatcaatggaagatcat
attaatccgaactgtcacggacgctggttaaaagcgatcgacgtgaactatcacgacagc
ggtgcgacgattcgctttagctcaagttggggcgatggcgaaattgaaagccatctgatg
ggcgcttttaacgtcagcaacctgctgctcgcgctggcgacactgttggcactcggctat
ccattggctgatctgttgaaaaccgccgcgcgtctgcaaccggtttgcggacgtatggaa
gtgttcactgcgccaggcaaaccgacggtggtggtggattacgcgcatacgccggatgcg
ctggaaaaagccttacaggcggcgcggctgcactgtgcgggcaagctgtggtgcgtcttt
ggctgtggtggcgatcgcgataaaggtaagcgtccactgatgggcgcaattgccgaagag
tttgctgacgtggcggtggtgacggacgataacccgcgtaccgaagaaccgcgtgccatc
atcaacgatattctggcgggaatgttagatgccggacatgccaaagtgatggaaggccgt
gctgaagcggtgacttgcgccgttatgcaggctaaagagaatgatgtggtactggtcgcg
ggcaaaggccatgaggattaccagattgttggcaatcagcgcctggactactccgatcgc
gtcacggtggcgcgtttgctgggggtgattgcatga

DBGET integrated database retrieval system