KEGG   Escherichia coli P12b: P12B_c0387Help
Entry
P12B_c0387        CDS       T02030                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
elp  Escherichia coli P12b
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:elp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P12B_c0387 (hemB)
Enzymes [BR:elp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     P12B_c0387 (hemB)
Exosome [BR:elp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P12B_c0387 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(408907..409914)
Genome map
AA seq 335 aa AA seqDB search
MPLDSTNIRQTMTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEA
MPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQT
VPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMD
GQVQAIRQALDAAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREA
IRESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAID
EEKVVLESLGSIKRAGADLIFSYFALDLAEKKILR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcgattccacaaacatcaggcagaccatgacagacttaatccaacgccctcgt
cgcctgcgcaaatctcctgcgctgcgcgctatgtttgaagagacaacacttagccttaac
gacctggtgttgccgatctttgttgaagaagaaattgacgactacaaagccgttgaagcc
atgccaggcgtgatgcgcattccagagaaacatctggcacgcgaaattgaacgcatcgcc
aacgccggtattcgttccgtgatgacttttggcatctctcaccataccgatgaaaccggc
agcgatgcctggcgggaagatggactggtggcgcgtatgtcgcgcatctgcaagcagacc
gtgccagaaatgatcgttatgtcagacacctgcttctgtgaatacacttctcacggtcac
tgcggtgtgctgtgcgagcatggcgtcgacaacgacgcgactctggaaaatttaggcaag
caagccgtggttgcagctgctgcaggtgcagacttcatcgccccttccgccgcgatggac
ggccaggtacaggcgattcgtcaggcgctggacgctgcgggatttaaagatacggcgatt
atgtcgtattcgaccaagttcgcctcctccttttatggcccgttccgtgaagctgccgga
agcgcattaaaaggcgaccgcaaaagctatcagatgaacccaatgaaccgtcgtgaggcg
attcgtgaatcactgctggatgaagcccagggcgcagactgcctgatggttaaacctgct
ggagcgtacctcgacatcgtgcgtgagctgcgtgaacgtactgaattgccgattggcgcg
tatcaggtgagcggtgagtatgcgatgattaagttcgccgcgctggcgggtgctatagat
gaagagaaagtcgtgctcgaaagcttaggttcgattaagcgtgcgggtgcggatctgatt
ttcagctactttgcgctggatttggctgagaagaagattctgcgttaa

DBGET integrated database retrieval system