KEGG   Escherichia coli P12b: P12B_c0399Help
Entry
P12B_c0399        CDS       T02030                                 

Gene name
phoA
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
elp  Escherichia coli P12b
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:elp00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:elp00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:elp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
422053..423393
Genome map
AA seq 446 aa AA seqDB search
MPVLENRAAQGDITAPGGARRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARN
YAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVD
IHEKDHPTILEMAKAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNAL
EKGGKGSITEQLLNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVSDAASL
NSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMT
DKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTL
VIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYG
PHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttctggaaaaccgggctgctcagggcgatattactgcacccggcggtgctcgc
cgtttaacgggtgatcagactgccgctctgcgtgattctcttagcgataaacctgcaaaa
aatattattttgctgattggcgatgggatgggggactcggaaattactgccgcacgtaat
tatgccgaaggtgcgggcggcttttttaaaggtatagatgccttaccgcttaccgggcaa
tacactcactatgcgctgaataaaaaaaccggcaaaccggactacgtcaccgactcggct
gcatcagcaaccgcctggtcaaccggtgtcaaaacctataacggcgcgctgggcgtcgat
attcacgaaaaagatcacccaacgattctggaaatggcaaaagccgcaggtctggcgacc
ggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcgctggtggcacatgtg
acctcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgtccgggtaacgctctg
gaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgctcgtgccgacgttacg
cttggcggcggcgcaaaaacctttgctgaaacggcaaccgctggtgaatggcagggaaaa
acgctgcgtgaacaggcacaggcgcgtggttatcagttggtgagcgatgctgcctcactg
aattcggtgacggaagcgaatcagcaaaaacccctgcttggcctgtttgctgacggcaat
atgccagtgcgctggctaggaccgaaagcaacgtaccatggcaatatcgataagcccgca
gtcacctgtacgccaaatccgcaacgtaatgacagtgtaccaaccctggcgcagatgacc
gacaaagccattgaattgttgagtaaaaatgagaaaggctttttcctgcaagttgaaggt
gcgtcaatcgataaacaggatcatgctgcgaatccttgtgggcaaattggcgagacggtc
gatctcgatgaagccgtacaacgggcgctggaattcgctaaaaaggagggtaacacgctg
gtcatagtcaccgctgatcacgcccacgccagccagattgttgcgccggataccaaagct
ccgggcctcacccaggcgctaaataccaaagatggcgcagtgatggtgatgagttacggg
aactccgaagaggattcacaagaacataccggcagtcagttgcgtattgcggcgtatggc
ccgcatgccgccaatgttgttggactgaccgaccagaccgatctcttctacaccatgaaa
gccgctctggggctgaaataa

DBGET integrated database retrieval system