KEGG   Escherichia coli P12b: P12B_c0734Help
Entry
P12B_c0734        CDS       T02030                                 

Gene name
ybhC
Definition
Acyl-CoA thioester hydrolase ybgC precursor
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
elp  Escherichia coli P12b
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    P12B_c0734 (ybhC)
   00500 Starch and sucrose metabolism
    P12B_c0734 (ybhC)
Enzymes [BR:elp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     P12B_c0734 (ybhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(802430..803362)
Genome map
AA seq 310 aa AA seqDB search
MPGEYQGTVYVPAAPGGITLYGTGEKPIDVKIGLSLDGGMSPADWRHDVNPRGKYMPGKP
AWYMYDSCQSKRSDSIGVLCSAVFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDG
DQVQINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIEGDVDIVSGRGAVVFDN
TEFRVVNSRTQQEAYVFAPATLSNIYYGFLAVNSRFNAFGDGVAQLGRSLDVDANTNGQV
VIRDSAINEGFNTAKPWADAVISNRPFAGNTGSVDDNDEIQRNLNDTNYNRMWEYNNRGV
GSKVVAEAKK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtgagtatcagggaacggtatatgtccctgccgctccgggtggaattactctg
tacggtacaggtgaaaaaccgattgatgtgaagattgggctttcccttgatggtggcatg
agccctgccgactggcgtcacgacgtcaacccgcgcggcaaatatatgccaggtaaacca
gcgtggtatatgtacgatagctgccagagcaaacgcagcgacagtatcggtgttctctgc
tctgcggtcttctggtcacaaaacaatggcctgcaactgcaaaatctgaccatcgaaaac
acgctgggcgatagcgtagatgcaggtaaccatccggcggtggcactgcgtactgatggt
gaccaggtacagattaacaacgttaacattctcggtcgtcagaacaccttctttgtcacc
aacagcggtgtgcagaaccgtctggaaacaaatcgtcagccgcgtacgctggtgaccaac
agctacattgaaggggatgtggatatcgtttctggtcgcggcgcagtggtgttcgataac
accgaattccgcgtggtgaactcacgtactcagcaagaagcgtatgtgtttgcaccggct
acgctgtccaacatttactacggtttcctcgccgtaaacagccgtttcaatgctttcggt
gatggtgtggcgcaactgggccgctcgctggatgttgatgccaataccaacggtcaggtg
gtgatccgtgatagcgccatcaacgaaggttttaacacggctaaaccgtgggccgatgcg
gtgatctctaatcgtccgtttgcgggtaataccggcagcgtagatgataacgacgaaata
cagcgcaatctgaatgacactaactacaaccgcatgtgggaatacaataaccgcggcgtg
ggtagtaaagtggttgcagaggcgaagaagtaa

DBGET integrated database retrieval system