KEGG   Escherichia coli P12b: P12B_c1360Help
Entry
P12B_c1360        CDS       T02030                                 

Gene name
pfkB
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
elp  Escherichia coli P12b
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:elp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:elp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:elp00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:elp00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:elp00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:elp00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:elp00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1469497..1470141)
Genome map
AA seq 214 aa AA seqDB search
MMVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIF
PAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFR
QLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQNQGIRCIIDSSGEALSAALAIG
NIELVKPNQKETQCAGESRTHPARRCPQSRAGNR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattacc
ccgcaaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccgggggc
ggcggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttc
ccggcgggtggcgcgaccggcgaacacctggtttcactgttggcggatgaaaatgtcccc
gtcgctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagca
agcggtgaacagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgc
cagcttgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagc
ctgccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaccaa
gggatccgctgcatcatcgacagttctggcgaagcgttaagtgcagcactggcgattggt
aacatcgagttggttaagcctaaccaaaaagaaactcagtgcgctggtgaatcgcgaact
cacccagccagacgatgtccgcaaagccgcgcaggaaatcgttaa

DBGET integrated database retrieval system