KEGG   Escherichia coli P12b: P12B_c1360Help
Entry
P12B_c1360        CDS       T02030                                 

Gene name
pfkB
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
elp  Escherichia coli P12b
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:elp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P12B_c1360 (pfkB)
   01230 Biosynthesis of amino acids
    P12B_c1360 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P12B_c1360 (pfkB)
   00030 Pentose phosphate pathway
    P12B_c1360 (pfkB)
   00051 Fructose and mannose metabolism
    P12B_c1360 (pfkB)
   00052 Galactose metabolism
    P12B_c1360 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    P12B_c1360 (pfkB)
Enzymes [BR:elp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     P12B_c1360 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1469497..1470141)
Genome map
AA seq 214 aa AA seqDB search
MMVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIF
PAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFR
QLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQNQGIRCIIDSSGEALSAALAIG
NIELVKPNQKETQCAGESRTHPARRCPQSRAGNR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattacc
ccgcaaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccgggggc
ggcggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttc
ccggcgggtggcgcgaccggcgaacacctggtttcactgttggcggatgaaaatgtcccc
gtcgctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagca
agcggtgaacagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgc
cagcttgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagc
ctgccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaccaa
gggatccgctgcatcatcgacagttctggcgaagcgttaagtgcagcactggcgattggt
aacatcgagttggttaagcctaaccaaaaagaaactcagtgcgctggtgaatcgcgaact
cacccagccagacgatgtccgcaaagccgcgcaggaaatcgttaa

DBGET integrated database retrieval system