KEGG   Escherichia coli P12b: P12B_c1733Help
Entry
P12B_c1733        CDS       T02030                                 

Gene name
paaF
Definition
putative enoyl-CoA hydratase paaF
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
elp  Escherichia coli P12b
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:elp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    P12B_c1733 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    P12B_c1733 (paaF)
   00650 Butanoate metabolism
    P12B_c1733 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    P12B_c1733 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    P12B_c1733 (paaF)
   00310 Lysine degradation
    P12B_c1733 (paaF)
   00360 Phenylalanine metabolism
    P12B_c1733 (paaF)
   00380 Tryptophan metabolism
    P12B_c1733 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    P12B_c1733 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    P12B_c1733 (paaF)
   00281 Geraniol degradation
    P12B_c1733 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    P12B_c1733 (paaF)
   00627 Aminobenzoate degradation
    P12B_c1733 (paaF)
   00930 Caprolactam degradation
    P12B_c1733 (paaF)
Enzymes [BR:elp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     P12B_c1733 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1884132..1884899)
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacgagtattgttgctgacccttaaccgtccc
gccgcacgtaatgcgctaaataatgccctgctgatgcaactggtaaatgaactggaagct
gcggctaccgataccagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgtccgcagctatgggcgcgattgcaggcctttaataaaccacttatcgcagccgtcaat
ggttacgcgcttggggcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttgggttgccggaaatcactctcggcatcatgcctggcgcaggcgga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgctcagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcatcgaaaatggcacgtcactcgccgctg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctccgctttcttacaaaaacgcacgcccgactttaaaggacgctaa

DBGET integrated database retrieval system