KEGG   Escherichia coli P12b: P12B_c1785Help
Entry
P12B_c1785        CDS       T02030                                 

Gene name
ycjM
Definition
Glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
elp  Escherichia coli P12b
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:elp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P12B_c1785 (ycjM)
Enzymes [BR:elp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     P12B_c1785 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1946247..1947953)
Genome map
AA seq 568 aa AA seqDB search
MGPLPRKGNMKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVL
ITYADQFHSNDLKPLPTFNQFYHQWLQSIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAG
EWQDIQQLGECSHLMFDFVCNHMSAKSEWFKNYLQQHPGFEDFFIAVDPQTDLSAVTRPR
ALPLLTPFQMRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLAKGAEYVRLDAV
GFMWKEPGTSCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGAGDDEAH
MVYQFSLPPLVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPE
SEILELVEALQQEGALVNWKNNPDGTRSPYEINVTYMDALSRRESSDEERCARFILAHAI
LLSFPGVPAIYIQSILGSRNDYAGVEKIGYNRAINRKKYHSKEITRELNDEATLRHAVYH
ELSRLITLRRSHNEFHPDNNFTIDTINSSVMRIQRSNADGNCLTGLFNVSKNIQHVNITN
LHGRDLISEVDILGNEITLRPWQVMWIK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgctaccacggaaaggcaacatgaaacagaaaattacggattacctggacgaa
atctacggtggaacatttaccgcaactcatttacagaaacttgtaacgcgtcttgagagt
gcgaaacgattaattacacagcgacgtaaaaaacactgggatgaaagtgatgtcgtgtta
attacctatgccgatcaatttcacagcaatgatttaaaaccattacccacatttaatcag
ttttaccatcaatggctgcaaagcattttttcacatgttcatttgttgccgttttatcca
tggtcatctgatgatggcttttcggtaattgattatcatcaggtcgccagtgaagcgggg
gagtggcaggatattcagcaactcggtgaatgcagtcatttaatgtttgattttgtctgc
aaccatatgtcggcaaaaagtgaatggtttaaaaactatttacaacagcatccaggtttt
gaagatttttttattgccgttgacccgcaaaccgatctcagcgccgtcactcgcccgcgt
gcgttaccgttattaacgccattccagatgcgcgatcattcaacgcgccatttatggacc
acctttagtgacgatcaaattgacctgaattaccgtagccctgaagtgttgctggcgatg
gtggatgttttactctgttaccttgcgaaaggtgctgagtatgtccgcctggatgccgtt
ggctttatgtggaaagagccgggaacaagctgcatccatctggaaaaaacacatctgatt
atcaaactgttacggtcgattattgataacgttgcgccaggtacagtgatcattaccgag
accaatgttccgcataaagacaacattgcttactttggcgcaggcgatgacgaagcacat
atggtgtaccagttctcgctgccgccactggtgctgcatgcggtgcaaaaacagaacgtt
gaggcgctttgtgcgtgggcgcaaaacctgacactaccttccagcaacaccacctggttt
aacttcctcgcctctcacgatggcatcgggctaaacccgctacggggcttgttgcctgaa
agcgaaatattagagctggtcgaggcgttacagcaggaaggtgcattagtaaactggaaa
aataatcccgacggtacacgcagtccgtatgaaataaatgtgacctatatggatgcgtta
agccgccgtgagagtagcgatgaagaacgttgcgccaggtttatccttgcccatgcgatt
ttgttaagtttccccggtgtgccagcgatatatattcaaagtattcttggctcgcgtaat
gattacgcaggtgtcgaaaaaatcggatataaccgtgcgattaaccgtaaaaaatatcac
agtaaagagataacccgagaactgaacgatgaagctacattaaggcatgcggtatatcat
gagttgtcgcgtttaattacacttcgtcgcagccataacgagtttcatccggataataat
tttaccattgatacgattaattcatccgtaatgcgtattcaaagaagtaacgctgatggt
aattgtctgactggattgtttaatgtcagtaaaaatattcagcatgtaaatattactaat
ctgcatggtcgggatctgattagtgaagttgatatattgggtaatgaaataacgctgcgc
ccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system