KEGG   Escherichia coli P12b: P12B_c1867Help
Entry
P12B_c1867        CDS       T02030                                 

Gene name
lycV
Definition
Gifsy-2 prophage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
elp  Escherichia coli P12b
Brite
Enzymes [BR:elp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     P12B_c1867 (lycV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2031948..2032397)
Genome map
AA seq 149 aa AA seqDB search
MQTSPDGIALIKKFEGCRLTAYPDPGTGDAPWTIGYGWTHPVDGKPVKRGMTIDQQTADR
LLKTGLVGYENDVLKVVRVKLTQGQFDALVSFAYNVGSRALSTSTLLKKLNAGDIKGAAD
EFLRWNKSGGKVMPGLTNRRKAERALFLS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtcctgacggaattgctctgataaaaaaatttgaaggttgtcggctgact
gcttaccccgaccccggaacgggagatgcgccgtggaccatcggctatggctggacccat
ccggttgacggaaagccagtaaagcgcggtatgactatcgaccagcaaaccgctgacagg
cttctgaaaacagggcttgttggttatgagaatgacgtgctgaaagttgtcagggtgaag
ctgacacaaggccagttcgacgcactggtgtcgttcgcttacaacgttgggtcgcgtgct
ctttccacatctacactgctgaaaaagctgaatgctggcgatataaaaggcgcggcagat
gaatttctgcgctggaataaatcaggcggaaaggtgatgccggggctcacgaatcgccgc
aaggcagagcgagctctgttcctgtcatga

DBGET integrated database retrieval system