KEGG   Escherichia coli P12b: P12B_c2000Help
Entry
P12B_c2000        CDS       T02030                                 

Gene name
nagZ
Definition
Beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
elp  Escherichia coli P12b
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:elp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    P12B_c2000 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    P12B_c2000 (nagZ)
Enzymes [BR:elp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     P12B_c2000 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2173297..2174310)
Genome map
AA seq 337 aa AA seqDB search
MLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIRAASRNRLVVAVDQE
GGRVQRFREGFTRLPAAQSFAALSGMEEGGKLAQEAGWLMASEMIAMDIDISFAPVLDVG
HISAAIGERSYHADPQKALAIASRFIDGMHEAGMKTTGKHFPGHGAVTADSHKETPCDPR
PQAEIRAKDMSVFSSLIRENKLDAIMPAHVIYSDVDPRPASGSPYWLKTVLRQELGFDGV
IFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERVTRLY
HKGSFSRQELMDSARWKAISTRLNQLHERWQEEKAGH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtcgaaggttacgaactggacgcggaagagcgtgaaatactggcgcatccg
ctggtgggagggctgattctctttacgcgtaactatcatgatcctgcccagttacgtgaa
ctggtgcgccagatccgcgcagcttcgcgcaatcgtctggtggtggcggttgatcaggaa
ggtggacgcgtgcagcgttttcgtgaaggttttacccgcttgccagcggcgcaatcattc
gctgcgctgtcaggaatggaagagggtggcaaactggcgcaggaggcaggttggttgatg
gccagcgaaatgatcgctatggatattgatatcagctttgcgcctgtgctggatgtcggg
catatcagcgcggcgattggcgagcgttcttatcatgccgatccacaaaaagccctggca
attgccagccggtttattgatggtatgcatgaagccggaatgaaaacgaccgggaaacac
ttcccaggacacggtgcagtaacggcagactcacacaaagaaacaccgtgcgatccacgt
ccacaagcggagattcgcgctaaagatatgtcggtcttcagttccttaatccgcgaaaat
aaactcgacgccattatgcctgcgcatgtgatctacagtgatgttgatccgcgtccggcg
agcggttctccctactggctgaaaaccgttttgcgtcaggaactgggttttgacggcgtg
attttctctgacgatttatcgatggaaggtgccgcgattatgggcagttatgccgaacgc
gggcaggcttcactggatgcgggttgcgatatgatcctggtctgcaataatcgtaaaggg
gccgtcagcgtgttagataatctgtcaccgatcaaggcagaacgtgttacacgtttgtat
cataaaggttcattttcgcgacaggaactgatggactcggctcgctggaaagcgatcagc
acccgtctgaatcagttacatgaacgctggcaggaagagaaagcaggtcactaa

DBGET integrated database retrieval system