KEGG   Escherichia coli P12b: P12B_c2574Help
Entry
P12B_c2574        CDS       T02030                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
elp  Escherichia coli P12b
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:elp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P12B_c2574 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    P12B_c2574 (dapE)
Enzymes [BR:elp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     P12B_c2574 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2804578..2805639
Genome map
AA seq 353 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQNFWAWRGQGET
LAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPN
HTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKIMNV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacaacagcttattcgccgcccttccctgagtcct
gatgatgcaggatgccaggctttgttgattgaacgtttgcaggcgatcggttttaccgtt
gaacgcatggactttgccgatacgcagaatttttgggcatggcgtgggcagggtgaaacg
ttagcctttgccgggcataccgacgtggtgccgcctggcgacgccgatcgttggatcaat
cccccgtttgaacccaccattcgtgacggcatgttattcgggcgcggtgcggcagatatg
aaaggctcgctggcggcgatggtggtggcggcagaacgttttgtcgcacaacatcccaac
catacggggcgactggcatttctgatcacctctgatgaagaagccagtgcccacaacggt
acggtaaaagtcgtcgaagcgttaatggcacgtaatgagcgtctcgattactgcctggtt
ggcgaaccgtcgagtatcgaagtggtaggtgatgtggtgaaaaatggtcgtcgcggatca
ttaacctgcaaccttaccattcatggcgttcaggggcatgttgcctacccacatctggct
gacaatccggtacatcgcgcagcacctttccttaatgaattagtggctattgagtgggat
cagggcaatgaattcttcccggcgaccagtatgcagattgccaatattcaggcgggaacg
ggcagtaacaacgttattccgggtgaactgtttgtgcagtttaacttccgcttcagcacc
gaactgactgatgagatgatcaaagcgcaggtgcttgccctgcttgaaaaacatcaactg
cgctatacggtggattggtggctttccgggcagccatttttgaccgcgcgcggtaaactg
gtggatgcggtcgttaacgcggttgagcactataatgaaattaaaccgcagctactgacc
acaggcggaacgtccgacgggcgctttattgcccgcatgggggcgcaggtggtggaactc
gggccggtcaatgccactattcataaaattatgaatgtgtga

DBGET integrated database retrieval system