KEGG   Escherichia coli P12b: P12B_c2913Help
Entry
P12B_c2913        CDS       T02030                                 

Gene name
recD
Definition
Exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
elp  Escherichia coli P12b
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:elp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3175804..3177630)
Genome map
AA seq 608 aa AA seqDB search
MKLQKQLLEAVEHKQLRPLDVQFALTVAGDEHPAVTLAAALLSHDAGEGHVCLPLSRLEN
NEASHPLLATCVSEIGELQNWEECLLASQAVSRGDEPTPMILCGDRLYLNRMWCNERTVA
RFFNEVNHAIEVDEALLAQTLDKLFPVSDEINWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIFLGDRDQ
LASVEAGAVLGDICAYANAGFTAERARQLSRLTGTHVPAGTGTEAASLRDSLCLLQKSYR
FGSDSGIGQLAAAINRGDKTAVKTVFQQDFTDIEKRLLQSGEDYIAMLEEALAGYGRYLD
LLQARAEPDLIIQAFNEYQLLCALREGPFGVAGLNERIEQFMQQKRKIHRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGTRVWFAMPDGNIKSVQPSRLPEHETTWAMTVHK
SQGSEFDHAALILPSQRTPVVTRELVYTAVTRARRRLSLYADERILSAAIATRTERRSGL
AALFSSRE
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcaaaagcaattactggaagctgtggagcacaaacagctacgcccgctggat
gtgcaatttgccctgaccgtggcgggagatgaacatcctgccgtcaccctcgcggcggca
ctgttaagtcatgatgccggagagggacacgtttgtttgccgctttcacgactggaaaat
aacgaggcgtcgcatccgctgttggcgacctgtgtcagtgaaatcggtgagctacaaaat
tgggaagaatgcttgctggcttctcaagcggtcagcaggggagatgaacccacgccgatg
atcctctgtggcgatcgtctttatttgaatcgcatgtggtgtaacgagcgcacagtggca
cgctttttcaacgaagtgaatcatgccattgaggttgatgaagctctactggcgcaaacc
ctggacaaactttttccagtaagcgatgaaattaactggcaaaaagttgcggcggcagtg
gcgctgacgcggcggatctcggtgatttccggcggccctggcaccggtaaaacgaccacc
gtagcgaagttgctggcagcgttaattcaaatggccgacggcgaacgctgccgtatccgt
ctggctgcaccaacgggtaaagctgccgcgcgcttaaccgaatctctcggcaaggctttg
cgacagttaccgctgaccgatgaacaaaagaaacgcattccggaagatgccagcactttg
caccgattgctgggcgcgcagccgggtagccagcgtttacgtcatcatgccggtaacccg
ctgcatcttgatgtgctggtggtagatgaagcgtcaatgatcgatctgcctatgatgtcg
agactgatcgacgccttgcccgatcatgcgcgagtgatctttctcggcgatcgtgatcaa
ctggcctcggttgaggctggggctgtgctgggcgatatctgcgcttatgccaacgcgggc
tttaccgccgagcgtgccaggcagctaagccgcctgacggggactcacgttccggcagga
accggcacagaagcggcatctttgcgcgacagtctctgcctgctgcaaaaaagctatcgt
ttcggcagcgattctggcattggtcagttagctgcggcgatcaaccgtggtgataaaacg
gcagtgaaaaccgtttttcagcaggattttactgatatcgaaaaacggcttttacagagc
ggcgaagattatattgcgatgcttgaggaagctcttgcgggttacggacgttatctggat
ctgctgcaagcgcgtgccgagccggatttaatcattcaggcgttcaatgagtaccagctt
ttgtgcgccctgcgggaagggccgtttggcgtggctggactgaatgagcgaattgagcag
tttatgcaacagaagcgcaaaattcatcgtcatccgcactctcgttggtacgaaggtcga
ccggtgatgattgcccgtaatgacagcgcgcttgggttgtttaatggcgatatcggtatt
gcgctggatcgcgggcaggggacgcgcgtctggtttgcgatgccggacggcaatattaag
tctgtgcaaccgagtcgcttgccagagcacgaaactacgtgggcgatgacggtacataaa
tcgcagggatcggagttcgaccatgcggcgttgattttgccgagccaacgcacgccggta
gtaacgcgagagctggtttataccgcggtgacccgcgcgcgtcgccgtctgtcgctgtat
gccgatgagcgcatattaagtgcggcaatcgccactcgtactgagcggcgcagtggtctg
gcggcgttgtttagttcacgggaataa

DBGET integrated database retrieval system