KEGG   Escherichia coli P12b: P12B_c2995Help
Entry
P12B_c2995        CDS       T02030                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase bglA
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
elp  Escherichia coli P12b
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:elp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P12B_c2995 (bglA)
Enzymes [BR:elp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     P12B_c2995 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3276733..3277926
Genome map
AA seq 397 aa AA seqDB search
MGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLV
QQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEINNQRNWRAPLFGYCCSGVVYT
EHENPEETMYQVLHHQFVASALAVKAARRINPEMKVGCMLAMVPLYPYSCNPDDVMFAQE
SMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLDVLREGTCDYLGFSYYMTNAV
KAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYALCELYERYQRPLFIVENGFGA
YDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGYTPWGCIDCVSFTTGQYSKRY
GFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcaaatgttttcgtacatccattgcctggacgcgcatttttccaaaaggcgat
gaagctcagccaaacgaagaagggctgaagttctacgatgatatgttcgatgaactgctg
aaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcatctggtg
cagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtacgtttcgcggaa
gtggtatttgaacgctataagcacaaagtcaaatactggatgaccttcaacgaaattaac
aaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtgtatacc
gagcatgaaaacccggaagagacgatgtatcaggtgctgcatcaccagtttgtcgccagc
gccctggcggtgaaagctgcgcgtcgcattaacccggagatgaaagtcggctgtatgctg
gcgatggtgccgctctatccttactcctgtaacccggacgatgtgatgttcgctcaggag
tcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccgtcctat
gtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagacggcgatctggat
gtgctgcgtgaaggcacctgcgattatcttggtttcagctattacatgaccaatgcagtg
aaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtaccaaacccg
tatgttaaagcatctgactggggctggcagattgatccagtaggtctgcgctatgcactt
tgcgaactgtatgagcgttatcagaggccgctgtttattgtcgaaaacggttttggcgct
tacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactacctgcgc
gcccatatcgaagagatgaaaaaagcggtgacttacgatggcgtggatctgatgggctac
acaccgtggggctgcatcgactgcgtgtcgttcaccaccgggcagtacagcaaacgctac
ggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttcacgtaag
aagagctttaactggtacaaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system