KEGG   Escherichia coli P12b: P12B_c3517Help
Entry
P12B_c3517        CDS       T02030                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
elp  Escherichia coli P12b
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P12B_c3517 (malQ)
Enzymes [BR:elp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     P12B_c3517 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3815559..3817643)
Genome map
AA seq 694 aa AA seqDB search
MESKRLDNAALAAGISPNYINAHGKPQSISAETKRRLLDAMHQRTATKVAVTPVPNVMVY
TSGKKMPMVVEGSGEYSWLLTTEEGTQYKGHVTGGKAFNLPTKLPEGYHTLTLTQDDQRA
HCRVIVAPKRCYEPQALLNKQKLWGACVQLYTLRSEKNWGIGDFGDLKAMLVDVAKRGGS
FIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFHLSEEAQAWWQLPTTQQT
LQQARDADWVDYSTVTALKMTALRMAWKGFAQRDDEQMAAFRQFVADQGDSLFWQAAFDA
LHAQQVKEDEMRWGWPAWPEMYQNVDSPEVRQFCEEHRDDVDFYLWLQWLAYSQFAACWE
ISQGYEMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDP
HIITARAYEPFIELLRANMQNCGALRIDHVMSMLRLWWIPYGETADQGAYVHYPVDDLLS
ILALESKRHRCMVIGEDLGTVPVEIVGKLRSSGVYSYKVLYFENDHEKTFRAPKAYPEQS
MAVAATHDLPTLRGYWESGDLTLGKTLGLYPDEVVLRGLYQDRELAKQGLLDALHKYGCL
PKRAGHKASLMSMTPTLNRGLQRYIADSNSALLGLQPEDWLDMAEPVNIPGTSYQYKNWR
RKLSATLETMFADDGVNKLLKDLDRRRRAAAKKK
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaacgtctggataatgccgcgctggcggcggggattagccccaattacatc
aatgcccacggtaaaccgcagtcgattagcgccgaaaccaaacggcgtttgcttgacgcg
atgcatcaacgtaccgccacgaaagtggcggtaacgccagtcccgaatgtcatggtttat
accagcggcaaaaaaatgccgatggtggtggagggcagcggcgaatatagctggctgctg
accaccgaagaaggaacacagtacaaaggccatgtaacggggggcaaagcgttcaatcta
ccgacgaagctgccggaaggttatcacacgctgacactcacccaggacgaccagcgcgcg
cattgccgggtgattgtcgccccgaagcgctgttacgaaccgcaggcgttgctgaataaa
caaaagctgtggggtgcctgcgtccagctttatacgctgcgatcggaaaaaaactggggt
attggggattttggcgatctcaaagcgatgctggtggatgtggcaaaacgtggcgggtcg
ttcatcggcctgaacccgattcatgcgctctatccggcaaatccggagagtgccagccca
tacagcccgtcttctcgccgttggctgaatgtgatttatatcgacgttaacgccgttgaa
gatttccatcttagcgaagaggctcaggcctggtggcagttgccgaccacgcaacagacg
ctgcaacaggcgcgcgatgccgactgggtcgattactccacggttaccgccctaaaaatg
acagcattacgaatggcgtggaaaggtttcgcgcaacgtgatgatgagcagatggccgcg
tttcgccagtttgttgcagatcaaggcgacagcctgttctggcaggcagcctttgatgcg
ctacatgcccagcaagtgaaagaggacgaaatgcgctggggctggcctgcatggccagag
atgtatcagaacgtggattcaccagaagtgcgtcagttctgcgaagaacatcgtgatgac
gttgatttttatctctggttgcagtggctggcttacagccagtttgccgcctgctgggag
ataagccagggctatgaaatgccgattggcttgtatcgtgatctggcggttggcgtagcg
gaaggtggggcggaaacctggtgtgaccgtgaactgtattgcctgaaagcgtcggttggc
gcgccgccggatatcctcggcccgttggggcagaactggggattaccgccaatggacccg
catattattaccgcgcgtgcctatgaaccgtttatcgagctgttgcgtgccaatatgcaa
aactgcggcgcattacgaattgaccatgtgatgtcgatgctgcgtttgtggtggataccg
tatggcgagacggcagatcagggcgcgtatgttcactatccggtggatgatctgctttcg
attctggcactcgaaagtaaacgtcatcgctgtatggtgattggtgaagatctcggtacc
gtaccggtagagattgtcggtaagctgcgcagcagcggtgtgtactcctacaaagtgctc
tatttcgaaaacgaccacgagaagacgttccgtgcaccgaaagcgtatccggagcagtcg
atggcggttgcggcgacacatgacctgcctacgctacgcggctactgggagagcggggat
ctaacgctgggcaaaaccctggggctgtatccggatgaagtggtactgcgcggtctgtat
caggatcgcgaactggcgaagcaagggctgctggatgcactgcataaatatggttgtctg
ccaaaacgtgccgggcataaggcatcgttgatgtcgatgacgccgacgcttaatcgtggt
ttgcagcgctacattgccgacagtaacagtgctctgttaggactacagccggaagactgg
ctggatatggccgaaccggtgaatattcctggcaccagttaccagtataaaaactggcgg
cgcaagctctccgcaacgcttgagacgatgtttgccgatgatggcgtgaacaagttgctg
aaggatttggacagacggcgcagagctgcagcgaagaagaagtag

DBGET integrated database retrieval system