KEGG   Escherichia coli P12b: P12B_c3694Help
Entry
P12B_c3694        CDS       T02030                                 

Gene name
xylA
Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
elp  Escherichia coli P12b
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:elp00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:elp00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4031167..4032501)
Genome map
AA seq 444 aa AA seqDB search
MEFNMQAYFDQLDRVRYEGSKSSNPLAFRHYNPDELVLGKRMEEHLRFAACYWHTFCWNG
ADMFGVGAFNRPWQQPGEALALAKRKADVAFEFFHKLHVPFYCFHDVDVSPEGASLKEYI
NNFAQMVDVLAGKQEESGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMEA
THKLGGENYVLWGGREGYETLLNTDLRQEREQLGRFMQMVVEHKHKIGFQGTLLIEPKPQ
EPTKHQYDYDAATVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVD
ANRGDAQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGH
IGAMDTMALALKIAARMIEDGELDKRIAQRYSGWNSELGQQILKGQMSLADLAKYAQEHN
LSPVHQSGRQEQLENLVNHYLFDK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggagttcaatatgcaagcctattttgaccagctcgatcgcgttcgttatgaaggctca
aaatcctcaaacccgttagcattccgtcactacaatcccgacgaactggtgttgggtaag
cgtatggaagagcacttgcgttttgccgcctgctactggcacaccttctgctggaacggg
gcggatatgtttggtgtgggggcgtttaatcgtccgtggcagcagcctggtgaggcactg
gcgttggcgaagcgtaaagcagatgtcgcatttgagtttttccacaagttacatgtgcca
ttttattgcttccacgatgtggatgtttcccctgagggcgcgtcgttaaaagagtacatc
aataattttgcgcaaatggttgatgtcctggcaggcaagcaagaagagagcggcgtgaag
ctgctgtggggaaccgccaactgctttacaaaccctcgctacggcgcgggtgcggcgacg
aacccagatcctgaagtcttcagctgggcggcaacgcaagttgttacagcgatggaagca
acccataaattgggcggtgaaaactatgtcctgtggggcggtcgtgaaggttacgaaacg
ctgttaaataccgacttgcgtcaggagcgtgaacaactgggccgctttatgcagatggtg
gttgagcataaacataaaatcggtttccagggcacgttgcttatcgaaccgaaaccgcaa
gaaccgaccaaacatcaatatgattacgatgccgcgacggtctatggcttcctgaaacag
tttggtctggaaaaagagattaaactgaacattgaagctaaccacgcgacgctggcaggt
cactctttccatcatgaaatagccaccgccattgcgcttggcctgttcggttctgtcgac
gccaaccgtggcgatgcgcaactgggctgggacaccgaccagttcccgaacagtgtggaa
gagaatgcgctggtgatgtatgaaattctcaaagcaggcggtttcaccaccggtggtctg
aacttcgatgccaaagtacgtcgtcaaagtactgataaatatgatctgttttacggtcat
atcggcgcgatggatacgatggcactggcgctgaaaattgcagcgcgcatgattgaagat
ggcgagctggataaacgcatcgcgcagcgttattccggctggaatagcgaattgggccag
caaatcctgaaaggccaaatgtcactggcagatttagccaaatatgctcaggaacataat
ttgtctccggtgcatcagagtggtcgccaggagcaactggaaaatctggtaaatcattat
ctgttcgacaaataa

DBGET integrated database retrieval system