KEGG   Escherichia coli P12b: P12B_c3763Help
Entry
P12B_c3763        CDS       T02030                                 

Gene name
mutM
Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
elp  Escherichia coli P12b
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:elp03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4112587..4113396)
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDQPVLSVQRRAKYLL
LELPEGWIIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKEL
EGHNVLAHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAG
IHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRVCGTPIVATKHAQRATFYCRQCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaaaccagccgtcgcggcatagaaccgcatctcgttggt
gcaaccattcttcatgcagtggtgcgcaacggacgcttgcgctggccggtttcagaagag
atctaccgtttaagcgaccaaccagtgcttagcgtgcagcggcgggctaaatatttgctg
ctggagctgcctgagggctggattatcattcatttggggatgtctggcagcctgcgcatc
cttccagaagaacttccccctgaaaagcatgaccacgtggatttggtgatgagcaacggt
aaagtgctgcgctacaccgatccgcgccgctttggtgcctggctgtggaccaaagagctg
gaagggcataatgtgctggcccatcttggaccggagccgctcagcgacgatttcaatggt
gagtatctgcatcagaagtgcgcgaagaaaaaaacggcgattaaaccgtggctgatggat
aacaagctggtggtaggggtagggaatatctatgccagcgaatcactgtttgcggcgggg
atccatccggatcggctggcgtcatcactgtcgctggcagagtgtgaattgttagctcgg
gtgattaaagcggtgttgctgcgttcgattgagcagggcggtacaacgctgaaagatttt
ctgcaaagtgatggtaaaccgggctatttcgcacaggaattgcaggtttacgggcgaaaa
ggcgagccgtgtcgggtgtgcggtacgccgattgtggcgactaaacatgcgcagcgggca
acgttttattgtcggcagtgccagaagtaa

DBGET integrated database retrieval system