KEGG   Escherichia coli P12b: P12B_c4041Help
Entry
P12B_c4041        CDS       T02030                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
elp  Escherichia coli P12b
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    P12B_c4041 (glpK)
Enzymes [BR:elp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     P12B_c4041 (glpK)
Exosome [BR:elp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P12B_c4041 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4420976..4422505)
Genome map
AA seq 509 aa AA seqDB search
MTTGQLNMTEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEI
WATQSSTLVEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEIC
EHLKRDGLEDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWK
MTQGRVHVTDYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSSEVYGQTNIGGK
GGTRIPISGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIAC
GPTGEVNYALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLG
APYWDPYARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGA
VANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRP
GIETTERNYRYAGWKKAVKRAMAWEEHDE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgactacgggacaattaaacatgactgaaaaaaaatatatcgttgcgctcgaccagggc
accaccagctcccgcgcggtcgtaatggatcacgatgccaatatcattagcgtgtcgcag
cgcgaatttgagcaaatctacccaaaaccaggttgggtagaacacgacccaatggaaatc
tgggccacccaaagctccacgctggtagaagtgctggcgaaagccgatatcagttccgat
caaattgcagctatcggtattacgaaccagcgtgaaaccactattgtctgggaaaaagaa
accggcaagcctatctataacgccattgtctggcagtgccgtcgtaccgcagaaatctgc
gagcatttaaaacgtgacggtttagaagattatatccgcagcaataccggtctggtgatt
gacccgtacttttctggcaccaaagtgaagtggatcctcgaccatgtggaaggctctcgc
gagcgtgcacgtcgtggtgaattgctgtttggtacggttgatacgtggcttatctggaaa
atgactcagggccgtgtccatgtgaccgattacaccaacgcctctcgtaccatgttgttc
aacatccataccctggactgggacgacaaaatgctggaagtgctggatattccgcgcgag
atgctgccagaagtgcgtcgttcttccgaagtatacggtcagactaacattggcggcaaa
ggcggcacgcgtattccaatctccgggatcgccggtgaccagcaggccgcgctgtttggt
cagttgtgcgtgaaagaagggatggcgaagaacacctatggcactggctgctttatgctg
atgaacactggcgagaaagcggtgaaatcagaaaacggcctgctgaccaccatcgcctgc
ggcccgactggcgaagtgaactatgcgttggaaggtgcggtgtttatggcaggcgcatcc
attcagtggctgcgcgatgaaatgaagttgattaacgacgcctacgattccgaatatttc
gccaccaaagtgcaaaacaccaatggtgtgtatgtggttccggcatttaccgggctgggt
gcgccgtactgggacccgtatgcgcgcggggcgattttcggtctgactcgtggggtgaac
gctaaccacattatacgcgcgacgctggagtctattgcttatcagacgcgtgacgtgctg
gaagcgatgcaggccgactctggtatccgtctgcacgccctgcgcgtggatggtggcgca
gtagcaaacaatttcctgatgcagttccagtccgatattctcggcacccgcgttgagcgc
ccggaagtgcgcgaagtcaccgcattgggtgcggcctatctcgcaggcctggcggttggc
ttctggcagaacctcgacgagctgcaagagaaagcggtgattgagcgcgagttccgtcca
ggcatcgaaaccactgagcgtaattaccgttacgcaggctggaaaaaagcggttaaacgc
gcgatggcgtgggaagaacacgacgaataa

DBGET integrated database retrieval system