KEGG   Escherichia coli P12b: P12B_c4178Help
Entry
P12B_c4178        CDS       T02030                                 

Gene name
acsA
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
elp  Escherichia coli P12b
Pathway
elp00010  Glycolysis / Gluconeogenesis
elp00620  Pyruvate metabolism
elp00640  Propanoate metabolism
elp00680  Methane metabolism
elp01100  Metabolic pathways
elp01110  Biosynthesis of secondary metabolites
elp01120  Microbial metabolism in diverse environments
elp01130  Biosynthesis of antibiotics
elp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:elp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P12B_c4178 (acsA)
   00620 Pyruvate metabolism
    P12B_c4178 (acsA)
   00640 Propanoate metabolism
    P12B_c4178 (acsA)
  Energy metabolism
   00680 Methane metabolism
    P12B_c4178 (acsA)
Enzymes [BR:elp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     P12B_c4178 (acsA)
Lipid biosynthesis proteins [BR:elp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   P12B_c4178 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFG42991
Position
complement(4606484..4608442)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINVPDTFWGEQGKILDWIKPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKYISYKELHRDVCRF
ANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDL
VEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgtacctgataccttctggggc
gaacagggaaaaattcttgactggatcaaaccttaccagaaggtgaaaaacacctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgatcgtaccgccatcatctgggaaggcgac
gacgccagccagagcaaatatatcagctataaagagctgcaccgcgacgtctgccgcttc
gccaataccctgctcgagctgggcattaaaaaaggtgatgtggtggcgatttatatgccg
atggtgccggaagccgcggttgcgatgctggcctgcgcccgcattggcgcggtgcattcg
gtgattttcggcggcttctcgccggaagccgttgccgggcgcattattgattccaactca
cgactggtgatcacttccgacgaaggtgtgcgtgccgggcgcagtattccgctgaagaaa
aacgttgatgacgcgctgaaaaacccgaacgtcaccagcgtagagcatgtggtggtactg
aagcgtactggcgggaaaattgactggcaggaagggcgcgacctgtggtggcacgacctg
gttgagcaagcgagcgatcagcaccaggcggaagagatgaacgccgaagatccgctgttt
attctctacacctccggttctaccggtaagccaaaaggtgtgctgcatactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggtgatatc
tactggtgcaccgccgatgtgggctgggtgaccggacacagttacttgctgtacggcccg
ctggcctgcggtgcgaccacgctgatgtttgaaggcgtacccaactggccgacgcctgcc
cgtatggcgcaggtggtggacaagcatcaggtcaatattctctataccgcacccacggcg
atccgcgcgctgatggcggaaggcgataaagcgatcgaaggcaccgaccgttcgtcgctg
cgcattctcggttccgtgggcgagccaattaacccggaagcgtgggagtggtactggaaa
aaaatcggcaacgagaaatgtccggtggtcgatacctggtggcagaccgaaaccggcggt
ttcatgatcaccccgctgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtgcaaccggcgctggtcgataacgaaggtaacccgctggagggggccacc
gaaggtagcctggtaatcaccgactcctggccgggtcaggcgcgtacgctgtttggcgat
cacgaacgttttgaacagacctacttctccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaagatggctattactggatcaccgggcgtgtggacgacgtgctg
aacgtctccggtcaccgtctggggacggcagagattgagtcggcgctggtggcgcatccg
aagattgccgaagccgccgtagtaggtattccgcacaatattaaaggtcaggcgatctac
gcctacgtcacgcttaatcacggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtagtcgagaag
ctgcttgaagagaagcaggctatcgcgatgccatcgtaa

DBGET integrated database retrieval system