KEGG   Escherichia coli P12b: P12B_c4457Help
Entry
P12B_c4457        CDS       T02030                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
elp  Escherichia coli P12b
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    P12B_c4457 (deoA)
Enzymes [BR:elp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     P12B_c4457 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4912127..4913320
Genome map
AA seq 397 aa AA seqDB search
MTIFFHDMTMPERVSLTMAMRDSGTVLDWKSLHLNGPIVDKHSTGGVGDVTSLMLGPMVA
ACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPA
DKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEA
IVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEM
LISGKLAKDDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAV
YADTEGFVSEMDTRALGMAVVAMGGGRRQASDTIDYSVGFTDMARLGDQVDGQRPLAVIH
AKDENSWQEAAKAVKAAIKLADKAPESTPTVYRRISE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccattttcttccacgatatgacaatgcctgagcgtgtctcgctgaccatggcgatg
cgagattcaggaaccgttctcgactggaaaagcctgcatctgaatggcccgattgttgat
aaacactcgaccggcggcgtcggcgatgtgacttcgctgatgttggggccgatggtcgca
gcctgcggcggctatattccgatgatctctggtcgcggcctcggtcatactggcggtacg
ctcgacaaactggaatccatccctggcttcgacattttcccggatgacaaccgtttccgc
gaaattattaaagacgtcggcgtggcgattatcggtcagaccagctcactggctccggcg
gataaacgtttctacgcgacccgtgatattaccgcaaccgtggactccatcccgctgatc
actgcctcgatcctggcgaagaaactggcggaaggtctggatgcgctggtgatggacgtg
aaagtgggtagcggcgcgtttatgccgacctacgaactctctgaagcccttgccgaagcg
attgttggcgtggctaacggcgctggcgtgcgcaccaccgcgctgctcaccgatatgaat
caggtgctggcctccagtgcaggtaacgcggttgaagttcgtgaagcggtgcagttcctg
acgggtgaatatcgtaacccgcgtctgtttgatgtcacgatggcgctgtgcgtggagatg
ctgatctccggcaaactggcgaaagatgacgccgaagcgcgcgcgaaattgcaggcggtg
ctggacaacggtaaagcggcagaagtctttggtcgtatggtagcggcacaaaaaggccca
accgacttcgttgagaactacgcgaagtatctgccgacagcgatgctgacgaaagcagtc
tatgctgataccgaaggttttgtcagtgaaatggatacccgcgcgctggggatggcagtg
gttgcaatgggcggcggacgccgtcaggcatctgacaccatcgattacagcgtcggcttt
actgatatggcgcgtctgggcgaccaggtagacggtcagcgtccgctggcggttatccac
gcgaaagacgaaaacagctggcaggaagcggcgaaagcggtgaaagcggcaattaaactt
gccgataaagcaccggaaagcacaccaactgtctatcgccgtattagcgaataa

DBGET integrated database retrieval system