KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_00420Help
Entry
ECO55CA74_00420   CDS       T02066                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ECO55CA74_00420 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECO55CA74_00420 (murE)
Enzymes [BR:elr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     ECO55CA74_00420 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
97727..99214
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKGEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGK
TTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVDQDATFC
AMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSEHHCGQAIIN
ADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVNYHDSGATIRFSSSWGDGEIE
SHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAH
TPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADVAVVTDDNPRTEE
PRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAKENDVVLVAGKGHEDYQIVGNQRLD
YSDRVTVARLLGVIA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgaccttcttgctccgtgggtgccagacgcaccttcgcga
gcactgcgagagatgacactcgacagccgtgtggctgcggcgggcgatctctttgtagct
gtagtaggtcatcaggcggacgggcgtcgatatatcccgcaggcgatagcgcaaggtgtg
gctgccattattgcagaggcgaaaggtgaggcgaccgacggtgaaatccgtgaaatgcac
ggcgtaccggtcatctatctcagccagctcaacgagcgtttatctgcactggcgggccgc
ttttaccatgaaccctctgacaatttacgtctcgtgggcgtaacgggcaccaacggcaaa
accacgacgacccagctgctggcgcagtggagccaactgcttggcgaaaccagcgcggta
atgggcaccgttggtaacggtctgctggggaaagtgatcccgacagaaaataccaccggt
tcggcagttgatgttcagcatgagctggcggggctggtggatcaggacgcgactttttgc
gcaatggaagtttcctcccacgggctggtacagcaccgtgtggcggcattgaaatttgcg
gcgtcggtctttactaacttaagccgcgatcaccttgattatcatggtgatatggaacac
tacgaagctgcgaaatggctgctttattctgaacatcattgcggtcaggcgattattaat
gccgacgatgaagtaggccgccgctggctggcaaaactgccggatgcagttgcggtatca
atggaagatcatatcaatccgaactgtcacggacgctggttgaaagcgaccgaagtgaac
tatcacgacagcggtgcgactattcgctttagctcaagttggggcgatggcgaaattgaa
agccatctgatgggcgcttttaacgtcagcaacctgctgctcgcgctggcgacgctgctg
gcgctgggctatccactggctgatctgctgaaaaccgctgctcgtctgcaaccggtttgc
ggacgtatggaagtgttcactgcgccaggcaaaccgacggtggtagtggattacgcgcat
acgccggatgcactggaaaaagccttacaggcggcgcgtctgcactgtgcgggcaagctg
tggtgtgtctttggctgtggtggcgatcgcgataaaggtaagcgtccactgatgggcgca
attgccgaagagtttgctgatgtggcggtggtgacggacgataatccgcgtaccgaagag
ccgcgtgccatcatcaacgatattctggcgggaatgttagatgccggacatgccaaagtg
atggaaggccgtgctgaagcggtgacttgcgccgttatgcaggctaaagagaacgatgtg
gtgctggtcgcgggcaaaggccatgaagattaccagattgttggcaatcagcgtctggac
tactccgatcgcgtcacggtggcgcgtctgctgggggtgattgcatga

DBGET integrated database retrieval system