KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_02230Help
Entry
ECO55CA74_02230   CDS       T02066                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ECO55CA74_02230
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECO55CA74_02230
   00650 Butanoate metabolism
    ECO55CA74_02230
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ECO55CA74_02230
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECO55CA74_02230
   00622 Xylene degradation
    ECO55CA74_02230
   00621 Dioxin degradation
    ECO55CA74_02230
Enzymes [BR:elr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ECO55CA74_02230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
468008..468958
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHDQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEEN
VDQLNVNMVTCGGQATIPMVAAVSRVVRVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttctggcaacattggcaccgatctgatgatt
aaaattttgcgtcacgatcagcatctggagatggcggtgatggtcggcattgatcctcag
tccgacggtctggcgcgtgccagacgtatgggcgtcgccaccacccatgaaggggtgatc
gggctgatgaacatgcctgaatttgctgatatcgacattgtatttgatgcgaccagcgcc
ggtgctcatgtgaaaaacgatgcggctttgcgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccttactgcgtgccggtggttaacctcgaggagaac
gtcgatcaactgaacgtcaacatggtcacctgcggcggccaggccaccattccaatggtg
gcggcagtttcacgcgtggtgcgtgttcattacgccgaaattatcgcttctatcgccagt
aaatctgccggacctggcacgcgtgccaatatcgatgaatttacggaaaccacttcgcga
gccattgaagtggtgggcggcgcggcaaaagggaaggcgattatcgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgacgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaggcggtgcaggcttacgtaccgggatat
cgcctgaaacagcgcgtgcagtttgaagttatcccgcaggataaaccggttaatttgccg
ggcgtagggcagttctccgggctgaaaacggcggtctggctggaagtcgaaggcgcagcg
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcagaaaaaatggcccagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system