KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_02315Help
Entry
ECO55CA74_02315   CDS       T02066                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:elr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(486545..487519)
Genome map
AA seq 324 aa AA seqDB search
MTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKH
LAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagacttaatccaacgccctcgtcgcctgcgcaaatctcctgcgctgcgcgctatg
tttgaagagacaacacttagccttaacgacctggtgttgccgatctttgttgaagaagaa
attgacgactacaaagccgttgaagccatgcctggcgtgatgcgcattccagagaaacat
ctggcacgcgaaattgaacgcatcgccaacgccggtattcgttccgtgatgactttcggc
atctctcaccataccgatgaaaccggcagcgatgcctggcgggaagatggactggtagcg
cgtatgtcgcgcatctgcaagcagacggtgccagaaatgattgtcatgtcagacacctgc
ttctgtgaatacacttctcacggtcactgcggtgtgctgtgcgagcatggcgtcgacaac
gacgcgactctggaaaatttaggcaagcaagccgtggttgcagctgctgcaggtgcagac
ttcatcgccccttccgccgcgatggatggccaggtacaggcgattcgccaggcgctggac
gctgctggctttaaagatacggcgattatgtcgtattcgaccaagttcgcctcctccttt
tatggtccgttccgtgaagctgccggaagcgcattaaaaggcgaccgcaaaagctatcag
atgaacccaatgaaccgtcgtgaggcgattcgtgagtcactgctggatgaagcccagggc
gcagactgcctgatggttaaacctgctggagcgtacctcgacatcgtgcgtgagctgcgt
gaacgtactgaattgccgattggcgcgtatcaggtgagcggtgagtatgcgatgattaag
ttcgccgcgctggcgggtgctatagatgaagagaaagtcgtgctcgaaagcttaggttcg
attaagcgtgcgggtgcggatctgattttcagctactttgcgctggatttggctgagaag
aagattctgcgttaa

DBGET integrated database retrieval system