KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_02370Help
Entry
ECO55CA74_02370   CDS       T02066                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECO55CA74_02370
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ECO55CA74_02370
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECO55CA74_02370
Enzymes [BR:elr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ECO55CA74_02370
Exosome [BR:elr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECO55CA74_02370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
498316..499731
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTADQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaa
gcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgcttaacggctgatcagaccgccgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggattcggaaatt
actgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggaaaaccggactac
gtcaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgccgcg
ctggtggcgcatgtgacctcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgt
ccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgct
cgtgccgacgttacgcttggcggcggcgcaaaaacctttgctgaaacggcaaccgctggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgagc
gatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctgcttggcctg
tttgctgacggcaatatgccagtgcgctggctaggaccgaaagcaacgtaccacggtaat
atcgataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagtgtaccgacc
ctggcacagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggctttttc
ctgcaagttgaaggtgcgtcaatcgataaacaggatcatgctgcgaatccttgtgggcaa
attggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattcgccaaaaag
gatggtaacacgctggtcatagtcaccgctgatcacgcccacgccagccagattgttgcg
ccggataccaaagctccgggcctcacccaggcgctaaataccaaagatggcgcagtgatg
gtgatgagttacgggaactccgaagaggattcacaagaacataccggcagtcagttgcgt
attgcggcgtatggcccgcatgccgccaatgtcgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgctctggggctgaaataa

DBGET integrated database retrieval system