KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_03000Help
Entry
ECO55CA74_03000   CDS       T02066                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ECO55CA74_03000
Enzymes [BR:elr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ECO55CA74_03000
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ECO55CA74_03000
Lipid biosynthesis proteins [BR:elr01004]
 Fatty acid synthase
  Component type
   ECO55CA74_03000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(650036..650662)
Genome map
AA seq 208 aa AA seqDB search
MMNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSK
TSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQD
VKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFLMEEVYLKPQWMQDD
GIHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaacaatgttttccgctggcatttgcccttcctgtttctggtcctgtta
accttccgtgccgccgcagcggacacgttattgattctgggtgatagcctgagcgccggg
tatcgaatgtctgccagcgcggcctggcctgccttgttgaatgataagtggcagagtaaa
acgtcggtagtcaatgccagcatcagcggcgacacctcgcaacaagggctggcgcgcctt
ccggctctgctgaaacagcatcagccgcgttgggtgctggttgaactgggcggcaatgac
ggtttgcgtggttttcagccacagcaaaccgagcaaacgctgcgccagattttgcaggat
gtcaaagccgccaacgctgaaccattgttaatgcaaatacgtctgcctgcaaactatggt
cgccgttataatgaagcctttagcgccatttaccccaaactcgccaaagagtttgatgtt
ccgctgctgccctttttaatggaagaggtctacctcaagccacaatggatgcaggatgac
ggtattcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttg
cagcctttagtaaatcatgactcataa

DBGET integrated database retrieval system