KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_04265Help
Entry
ECO55CA74_04265   CDS       T02066                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
elr00020  Citrate cycle (TCA cycle)
elr00190  Oxidative phosphorylation
elr00650  Butanoate metabolism
elr01100  Metabolic pathways
elr01110  Biosynthesis of secondary metabolites
elr01120  Microbial metabolism in diverse environments
elr01130  Biosynthesis of antibiotics
elr01200  Carbon metabolism
Module
elr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
elr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
elr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECO55CA74_04265 (sdhD)
   00650 Butanoate metabolism
    ECO55CA74_04265 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ECO55CA74_04265 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEZ39466
Structure
PDB: 

Jmol
Position
915905..916252
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFCASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgccaccagt
ggcgagctgacatatgaagtctggatcggtttctgcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggctttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system