KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_06670Help
Entry
ECO55CA74_06670   CDS       T02066                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:elr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:elr00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1415210..1416235
Genome map
AA seq 341 aa AA seqDB search
MGPVMLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIRAASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAQEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHADPEKALAIASRFIDGMHEAGMKTTGKHFPGHGAVTADSHKETP
CDPRPQAEIRAKDMSVFSTLIRENKLDAIMPAHVIYSDVDPRPASGSSYWLKTVLRQELG
FDGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TRLYHKGSFSRQELMDSARWKAISARLNQLHERWQEEKAGH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccagtaatgttggatgtcgaaggttacgaactggacgcggaagagcgtgaaata
ctggcgcatccgctggtgggagggctgattctctttacgcgaaactatcatgatcctgcc
cagttgcgtgaactggtgcgccagatccgcgcagcatcgcgcaatcatctggtggtggcg
gtagatcaggaaggtggacgcgtccagcgttttcgcgaaggttttacccgcttaccggca
gcacaatcctttgctgcgctgttgggaatggaagagggcggcaaactggcgcaagaggcg
ggttggctgatggccagcgaaatgatcgctatggatattgatatcagctttgcgccagtg
ctggatgtaggacatatcagcgcggcgattggcgagcgttcttatcatgccgacccagaa
aaagccctggcaatcgccagtcggtttattgatgggatgcatgaagccggaatgaaaacg
accgggaaacacttcccaggacacggtgcagtaactgcagattcacacaaagagacgccg
tgcgacccacgcccgcaagcggaaattcgtgccaaagatatgtcggttttcagcacgtta
atccgcgaaaataaactcgacgccattatgcctgcgcatgtgatctacagtgatgttgat
ccgcgtccggcgagcggttcttcctactggctgaaaaccgttttgcgtcaggaactgggt
tttgacggcgtgattttctctgacgatttatcgatggaaggtgccgcgattatgggcagt
tatgccgaacgcgggcaggcatcactggatgcgggttgcgatatgatcctggtctgcaat
aatcgtaaaggggccgtcagcgtgttagataatctgtcaccgatcaaggcagaacgtgtt
acacgtttgtatcataaaggttcattttcgcgacaggaactgatggactcggctcgctgg
aaagcgatcagcgcccgtctgaatcagttacatgaacgctggcaggaagagaaagcaggt
cactaa

DBGET integrated database retrieval system