KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_09540Help
Entry
ECO55CA74_09540   CDS       T02066                                 

Definition
putative endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1985083..1985616)
Genome map
AA seq 177 aa AA seqDB search
MNAKIRYGLSAAVLALIGAGASAPEILDQFLDEKEGNHTTAYRDGTGIWTICRGAILVDG
KPVVPGMKLSKEKCDQVNAIERDKALAWVEKNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYRRINAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALACWGIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaaaatcagatacggcctgtcggctgccgttctggcgctgattggtgcaggg
gcgtctgcgcctgaaatcctcgaccagtttctggatgaaaaggaaggtaaccacaccaca
gcataccgtgatggtacgggtatctggaccatctgccgcggtgccatcctggtggatggt
aaacctgtcgtcccgggcatgaagttgtcgaaggaaaaatgcgaccaggttaacgccatt
gagcgtgataaggcgctggcatgggtggagaaaaacatcaaagtgccgctgaccgaaccc
cagaaagcggggatcgcgtcattctgtccgtacaacattggtcccggtaagtgtttcccg
tcgacgttttacagacgaattaatgcaggtgatcgaaaaggtgcctgcgaagcgattcgc
tggtggattaaggacggtggcagagactgccgtattcgttcaaacaactgttacggtcag
gtatcccgtcgtgaccaggagagcgcgctggcgtgctggggaatcgacagataa

DBGET integrated database retrieval system