KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_11830Help
Entry
ECO55CA74_11830   CDS       T02066                                 

Definition
phage-related lysozyme (muraminidase)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Brite
Enzymes [BR:elr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECO55CA74_11830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2424036..2424569)
Genome map
AA seq 177 aa AA seqDB search
MNTKIKYGLSAAVLALIAAGAPAPDILDQFLDEKEGNHTTAYRDGAGIWTICRGAILVDG
KPVVPGMKLSKEKCDQVNAIERDKALAWVEKNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYRRINAGDRRGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALACWGIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaaaatcaaatacggcctgtcggctgccgttctggcgctgattgccgctggt
gcgcctgcgcctgacattctcgaccagtttctggatgaaaaggaaggtaaccacaccacg
gcataccgtgatggcgcgggtatctggaccatctgtcgcggtgccattctggtggatggt
aaacctgtcgtcccgggcatgaagttgtcgaaggagaaatgcgaccaggttaacgccatt
gagcgtgataaggcgctggcatgggtggagaaaaacatcaaagtgccattgaccgaaccc
cagaaagcggggatcgcgtcattctgtccgtacaacattggtcccggtaagtgtttcccg
tcgacgttttacagacgaattaatgctggtgatcgcaggggagcatgtgaggcgattcgc
tggtggattaaggacggtggcagagattgccgtattcgttcaaacaactgctacggtcag
gtatcccgtcgtgaccaggagagcgcgctggcgtgctggggtatcgacagataa

DBGET integrated database retrieval system