KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_12335Help
Entry
ECO55CA74_12335   CDS       T02066                                 

Definition
GalU regulator GalF (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECO55CA74_12335
   00052 Galactose metabolism
    ECO55CA74_12335
   00500 Starch and sucrose metabolism
    ECO55CA74_12335
   00520 Amino sugar and nucleotide sugar metabolism
    ECO55CA74_12335
Enzymes [BR:elr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECO55CA74_12335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2527197..2528090)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFLKNIEQLLAK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttataccggtagcaggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcagtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactactggcggaagtacaatctatctgtccgccgggcgtgaccattatg
aacgtgcgtcagggtgaacctttaggtttaggccactccattttatgtgcgcgacctgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgttgcgttacaaccttgctgccatgattgcgcgcttcaatgaaacgggccgtagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcatccagaccaaa
gaaccgctggatcgtgaaggtaaagtcagccgcattgttgaatttatcgaaaaaccggat
cagccgcagacgctggactcagacataatggccgttggtcgctatgtgctttctgccgat
atttggccggaacttgaacgcactcaacctggtgcatgggggcgtattcagctgactgat
gctattgccgaactggcgaaaaaacagtccgttgatgccatgctgatgactggtgacagc
tacgactgtggtaaaaaaatgggctatatgcaggcgttcgtgaagtatgggctgcgcaac
ctaaaggaaggtgcgaaatttctcaagaatattgagcaattacttgctaaataa

DBGET integrated database retrieval system