KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_14490Help
Entry
ECO55CA74_14490   CDS       T02066                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
elr00010  Glycolysis / Gluconeogenesis
elr00052  Galactose metabolism
elr00500  Starch and sucrose metabolism
elr00520  Amino sugar and nucleotide sugar metabolism
elr00521  Streptomycin biosynthesis
elr01100  Metabolic pathways
elr01110  Biosynthesis of secondary metabolites
elr01120  Microbial metabolism in diverse environments
elr01130  Biosynthesis of antibiotics
elr01200  Carbon metabolism
Module
elr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
elr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECO55CA74_14490 (glk)
   00052 Galactose metabolism
    ECO55CA74_14490 (glk)
   00500 Starch and sucrose metabolism
    ECO55CA74_14490 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ECO55CA74_14490 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECO55CA74_14490 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ECO55CA74_14490 (glk)
Enzymes [BR:elr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ECO55CA74_14490 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: AEZ41470
Structure
PDB: 

Jmol
Position
complement(2987904..2988869)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccgattaccggagactgggtggcaatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttaccgctgtatcgatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtagaaggtaagcctattgcggtttacggtgccggaacggggcttggg
gttgcgcatctggtccatgtcgataagcgttgggtaagcttgccgggcgaaggcggtcac
gttgattttgcgccgaatagtgaagaagaggccattatcctcgaaatattgcgtgcggaa
attggtcatgtttcggcggaacgcgtgctttctggcccaggactggtgaatttgtatcgc
gcaattgttaaagccgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgcgcgctggctgacagctgcaccgattgccgccgtgcgttgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcgctcaatctcgggacatttggcggcgtgtttatt
gcgggcggtatcgtgccgcgcttccttgagttcttcaaagcctctggtttccgtgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
catgacaatccgggtcttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctgtaa

DBGET integrated database retrieval system