KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_16950Help
Entry
ECO55CA74_16950   CDS       T02066                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECO55CA74_16950
Enzymes [BR:elr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECO55CA74_16950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3519765..3521198
Genome map
AA seq 477 aa AA seqDB search
MKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKYYP
NHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDSLFDELL
KYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINLEMKVGCML
AMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDSDLD
VLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYAL
CELYARYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGENL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgctcatcag
gtcgaaggcggctggaacaaaggcggaaaagggccgagcatttgtgacgttctgaccggt
ggcgcacacggcgtgccgcgcgaaataaccaaagaagtcttgccaggcaaatactatcca
aaccatgaagccgttgatttttatggtcactataaggaagacatcaagctatttgccgaa
atgggcttcaaatgttttcgtacatccattgcctggacgcgcatttttccaaaaggcgat
gaagctcagccaaacgaagaagggctgaagttctacgactctctgttcgatgaactgctg
aaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcatctggtg
cagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtacgtttcgcggaa
gtggtatttgaacgctataagcacaaagtcaaatactggatgaccttcaacgaaattaac
aaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtgtatacc
gagcatgaaaacccggaagagacgatgtatcaggtgctgcatcaccagtttgtcgccagc
gccctggcagtgaaagccgcgcgtcgcattaacctggagatgaaagtcggctgtatgctg
gcgatggtgccgctctatccctactcatgtaacccggacgatgtgatgttcgctcaggag
tcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccgtcgtat
gtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagatagcgatctcgat
gtactgcgcgaaggcacctgcgattatcttggtttcagctattacatgaccaacgcagtg
aaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtaccaaacccg
tatgttaaagcatctgactggggctggcagattgatccggtgggtctgcgttacgcactt
tgcgaactgtatgcgcgttaccagaagccgctgtttattgtcgaaaacggttttggcgct
tacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactacctgcgc
gcccatattgaagagatgaaaaaagcagtaacttacgatggcgtggatctgatgggctac
acaccgtggggctgcatcgactgcgtgtcgttcactaccgggcagtacagcaaacgctac
ggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttcacgtaag
aagagctttaactggtacaaagaagtgattgccagcaacggcgagaatctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system