KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_17140Help
Entry
ECO55CA74_17140   CDS       T02066                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ECO55CA74_17140
Enzymes [BR:elr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ECO55CA74_17140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3561555..3562475)
Genome map
AA seq 306 aa AA seqDB search
MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNH
SVQIGIRTEFDKDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttaggtcatcaatacgataactcactggtttccaacgcctttggtttttta
cgcctgccgatgaacttccagccgtatgacagcgatgctgactgggtgattactggtgtg
ccgttcgatatggccacttctggtcgtgcggggggacgccacggtccggcagctatccgt
caggtttcgacgaatctggcctgggaacacaaccgcttcccgtggaatttcgacatgcgt
gagcgtctgaacgtcgtggactgtggtgatctggtatatgctttcggcgatgcccgtgag
atgagcgagaagctgcaggcgcacgccgagaagctgctggctgccggtaagcgtatgctc
tccttcggtggtgaccactttgttacgctgccgctgctgcgtgctcatgcgaagcatttc
ggcaaaatggcgctggtacactttgacgcccacaccgatacctacgcgaacggttgtgaa
tttgaccacggcaccatgttctataccgcgccgaaagaaggtctgatcgacccgaatcat
tccgtgcagattggtattcgtaccgaatttgataaagacaacggctttaccgtgctggac
gcctgccaggtgaacgatcgcagcgtggatgacgttatcgcccaggtgaaacaaattgtg
ggtgatatgccggtttacctgacctttgatatcgactgcctggatcctgcatttgcgccg
ggaaccggtacgccggtaattggcggtctgacctccgatcgcgctattaaactggtacgc
ggcctgaaagatctcaacatcgttgggatggacgtagtggaagtggctccggcatacgat
cagtcggaaatcaccgctctggcagcggcaacgctggcgctggaaatgctgtatattcag
gcggcgaaaaagggcgagtaa

DBGET integrated database retrieval system