KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_17585Help
Entry
ECO55CA74_17585   CDS       T02066                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECO55CA74_17585
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECO55CA74_17585
   00630 Glyoxylate and dicarboxylate metabolism
    ECO55CA74_17585
Enzymes [BR:elr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ECO55CA74_17585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3653031..3655202)
Genome map
AA seq 723 aa AA seqDB search
MSQTITQGRLRIDANFKRFVDEEVLPGTGLDAAAFWRNFDEIVHELAPENRQLLAERDRI
QAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPERVTVETTGIDSEITSQAGPQLVVP
AMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRGEQVIAWVRRFLDESLPL
ENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDTAAPTCILLKNNGLHIEL
QIDANGRIGKDDPAHINDVIVEAAISTILDCEDSVAAVDAEDKILLYRNLLGLMQGTLQE
KMEKNGRQIVRKLNDDRQYTAADGSEISLHGRSLLFIRNVGHLMTIPVIWDSEGNEIPEG
ILDGVMTGAIALYDLKVQKNSRTGSVYIVKPKMHGPLEVAFANKLFTRIETMLGMAPNTL
KMGIMDEERRTSLNLRSCIAQAHNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMKSTP
WIKAYERNNVLSGLFCGLRGKAQIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTA
ATLHALHYHQTNVQSVQANIAQTEFNAEFEPLLDDLLTIPVAENANWSAQEIQQELDNNV
QGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATLRISSQHIANWLRHGILTKEKVQASL
ENMAKVVDQQNAGDPAYRPMAGNFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRLREK
ESH
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaccataacccagggccgtttacgcattgacgccaattttaaacgttttgtg
gatgaagaagttttaccgggaacagggctggacgctgcggcgttctggcgcaattttgat
gagatcgttcacgagctggcaccagaaaatcgtcagttgctggcagaacgcgatcgcatt
caggcggcgcttgatgagtggcatcgcagcaatccggggccggtaaaagataaagcggcc
tataaatctttcctgcgtgaactgggctacctggtgccgcaaccggagcgcgtgacggtg
gaaaccacgggcattgacagcgaaatcaccagtcaggcggggccacagctggtggttccg
gcaatgaacgcccgctacgcgctgaacgcggcgaacgctcgctggggctcactgtacgat
gcgttatacggcagcgacatcatcccgcaggaaggggcgatggtcagcggctacgatccg
caacgcggtgagcaggttatcgcctgggttcggcgtttcctcgatgaatctctaccgctg
gaaaacggcagctatcaggatgtggtggcgtttaaggtggtcgataaacaattacgcatc
cagttgaaaaatggtaaagaaaccacgttacgtaccccggcgcagtttgtcggttaccgt
ggcgataccgctgcgccgacctgcattttgctgaaaaataacggcctgcatattgagcta
caaatcgatgccaacgggcggattggcaaagacgatccggcgcacatcaacgatgttatc
gtcgaagcggccatcagtaccattctcgactgcgaagattcggtcgcggcggttgatgcg
gaagataaaatcctgctgtaccgcaacctgctgggcctgatgcaggggactctgcaagag
aaaatggagaaaaacggtcggcaaatcgtacgtaaactgaatgacgatcgtcagtacacc
gccgccgatggctctgaaatttctctgcacggacgctcgttgctgtttatccgcaacgtg
ggtcatttgatgaccattcctgtgatttgggacagcgaaggtaatgaaataccggaaggc
attcttgatggcgtcatgactggcgcgattgccctctatgatttaaaagtgcagaaaaac
tcgcgcactggcagcgtctatattgtgaaaccgaaaatgcacggtccgctggaagtggcg
ttcgccaacaaactgtttacccgcattgagacaatgctcggtatggcaccgaataccctg
aaaatgggcattatggatgaagaacgtcggacctcgctgaacttgcgtagctgtatcgct
caggcgcacaaccgcgtggcgttcatcaataccggtttcctcgaccgtaccggcgatgaa
atgcattcggtgatggaagctggcccgatgctgcgtaaaaatcagatgaaatcgacgcct
tggatcaaagcctacgagcgtaataacgtgctttccggtctgttctgtgggctgcgcggt
aaagcgcaaattggtaaaggcatgtgggcaatgccggacctgatggcagacatgtacagc
cagaagggcgaccaactgcgtgccggggcaaacacagcctgggttccgtcaccaaccgct
gctacgctccatgcgctgcactaccaccaaaccaacgtacagagcgtgcaagccaacatt
gcccagaccgagttcaatgctgaatttgaaccgctgctggacgatctgctgactattccg
gttgctgaaaatgctaactggtcggcgcaagagatccaacaagagctggataacaacgtg
caggggattctggggtacgtggtgcgctgggtggagcaggggattggttgttcaaaagtg
ccggatattcacaatgtggcgctgatggaagaccgcgcaacgctgcgtatctccagccag
catatcgccaactggttacgtcacggtattctgaccaaagaaaaggtgcaggcgtcgctg
gagaatatggcgaaagtggttgatcagcaaaacgctggcgatccggcttatcgtccgatg
gcggggaatttcgctaactcgtgtgcttttaaagctgccagcgatttgatcttcctcggc
gtgaaacagccaaacggttataccgaaccgttattacacgcctggcgtttacgcgaaaaa
gaaagtcattaa

DBGET integrated database retrieval system