KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_22265Help
Entry
ECO55CA74_22265   CDS       T02066                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
elr00071  Fatty acid degradation
elr00280  Valine, leucine and isoleucine degradation
elr00281  Geraniol degradation
elr00310  Lysine degradation
elr00362  Benzoate degradation
elr00380  Tryptophan metabolism
elr00410  beta-Alanine metabolism
elr00640  Propanoate metabolism
elr00650  Butanoate metabolism
elr00903  Limonene and pinene degradation
elr00930  Caprolactam degradation
elr01040  Biosynthesis of unsaturated fatty acids
elr01100  Metabolic pathways
elr01110  Biosynthesis of secondary metabolites
elr01120  Microbial metabolism in diverse environments
elr01130  Biosynthesis of antibiotics
elr01200  Carbon metabolism
elr01212  Fatty acid metabolism
Module
elr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECO55CA74_22265 (fadB)
   00650 Butanoate metabolism
    ECO55CA74_22265 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ECO55CA74_22265 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ECO55CA74_22265 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECO55CA74_22265 (fadB)
   00310 Lysine degradation
    ECO55CA74_22265 (fadB)
   00380 Tryptophan metabolism
    ECO55CA74_22265 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECO55CA74_22265 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECO55CA74_22265 (fadB)
   00281 Geraniol degradation
    ECO55CA74_22265 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECO55CA74_22265 (fadB)
   00930 Caprolactam degradation
    ECO55CA74_22265 (fadB)
Enzymes [BR:elr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECO55CA74_22265 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECO55CA74_22265 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECO55CA74_22265 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     ECO55CA74_22265 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AEZ42995
Position
complement(4620612..4622801)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLIEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLALGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFERVDVVVEAIVENPKVKKAVLAETEQKVRP
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWHYKEDSKGKP
KKEEDAAVDDLLAEVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgccgaactg
gtatttgatgccccaggttcagttaataaactcgacactgcgaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatctaaaagggctgctgctgcgttcgaac
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctgccggtgccgaccattgctgccgtcaatggctatgcgctgggcggtggctgcgaatgc
gtgctggcgaccgattaccgtctggcgacgccggatctgcgcatcggtctgccggaaacc
aaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctgggcgct
gacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggcgtagtcaaagcagaaaaactgattgaaggggcgatggcgatt
ttacgccaggccattaacggcgacctcgactggaaagcgaaacgtcagccgaagctggaa
ccgctaaaactgagcaagattgaagccaccatgagcttcaccatcgctaaagggatggtc
gcacaaacggcaggaaaacattacccggcccccatcaccgcagtaaaaaccattgaagct
gcggctcgttttggtcgtgaagaagccttaaacctagaaaacaaaagctttgtcccgctg
gcgcataccaacgaagctcgcgcactggtcggcattttccttaacgatcaatatgtaaaa
ggcaaagcgaagaaactcaccaaagacgttgaaaccccgaaacaggccgccgtgctgggc
gcaggcattatgggtggcggcatcgcttaccagtctgcgtggaaaggcgtgccggtgatt
atgaaagatattaacgacaagtcgttagccctcggcatgactgaagccgcgaaactactg
aacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatctccacg
atccacccaacgctcgactacgccggatttgagcgcgtggatgttgtggtagaagcgatt
gttgaaaacccgaaagtgaaaaaagccgtgctggcagaaaccgagcagaaagtacgcccg
gataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgtccggaaaacttctgcgggatgcacttctttaacccggtccaccgaatgccgttg
gtggaaattattcgcggcgagaaaagctccgacgaaactattgcgaaagtcgtcgcctgg
gcgagcaagatgggtaaaacgccgattgtggttaacgattgccccggcttcttcgtcaac
cgcgtgctgttcccgtatttcgccggtttcagccagttgctgcgcgacggcgcggatttc
cgcaagatcgacaaagtgatggaaaaacagtttggctggcctatgggtccggcatatctg
ctggacgttgtgggcattgacaccgcgcatcacgcccaggcagtcatggcagcgggcttc
ccacagcggatgcagaaagattatcgcgatgccatcgacgcgctgtttgatgccaaccgc
tttggtcagaagaacggcctcggtttctggcattataaagaagacagcaaaggtaagccg
aagaaagaagaagacgccgctgttgacgacctgctggcagaagtgagccagccgaagcgc
gatttcagcgaagaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtg
cgctgtctggaagaaggcattatcgccactccggcagaagcggatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctcggcagc
gcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtacgaagtgccg
gaaggtctgcgtaataaagcgcgtcataacgaaccgtactatcccccggttgagccagcc
cgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system