KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_22680Help
Entry
ECO55CA74_22680   CDS       T02066                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:elr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4711739..4713247)
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSST
LVEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDG
LEDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPI
SGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVN
YALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NYRYAGWKKAVKRAMAWEEHDE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaaaatatatcgttgcgctcgaccagggcaccaccagctcccgcgcggtc
gtaatggatcacgatgccaatatcattagcgtgtcgcagcgcgaatttgagcaaatctac
ccaaaaccaggctgggtagaacacgacccaatggaaatctgggccacccaaagctccacg
ctggtagaagtgctggcgaaagccgatatcagttccgatcaaattgcagctatcggtatt
acgaaccagcgtgaaaccactattgtctgggaaaaagaaaccggcaagcctatctataac
gccattgtctggcagtgccgtcgtaccgcagaaatctgcgagcatttaaaacgtgacggt
ttagaagattatatccgcagcaataccggtctggtgattgacccgtacttttctggcacc
aaagtgaagtggatcctcgaccatgtggaaggctctcgcgagcgtgcgcgtcgtggtgaa
ttgctgtttggtacggttgatacgtggcttatctggaaaatgactcagggccgtgtccat
gtgaccgattacaccaacgcctctcgtaccatgttgttcaacatccataccctggactgg
gacgacaaaatgctggaagtgctggatattccgcgcgagatgctgccagaagtgcgtcgt
tcttccgaagtgtacggtcagactaacattggcggcaaaggcggcacgcgtattccaatc
tccgggatcgccggtgaccagcaggccgcgctgtttggtcagttgtgcgtgaaagaaggg
atggcgaagaacacctatggcactggctgctttatgctgatgaacactggcgagaaagcg
gtgaaatcagaaaacggcctactgaccaccatcgcctgcggcccgactggcgaagtgaac
tatgcgttggaaggtgcggtgtttatggcaggcgcatccattcagtggctgcgcgatgag
atgaagttgattaacgacgcctacgattccgaatatttcgccaccaaagtgcaaaacacc
aatggtgtgtatgtggttccggcatttaccgggctgggtgcgccgtactgggacccgtat
gcgcgcggggcgattttcggtctgactcgtggggtgaacgctaaccacattatacgcgcg
acgctggagtctattgcttatcagacgcgtgacgtgctggaagcgatgcaggccgactct
ggtatccgtctgcacgccctgcgcgtggatggtggcgcagtagcaaacaatttcctgatg
cagttccagtctgatattctcggcacccgcgttgagcgcccggaagttcgcgaagtcacc
gcattgggtgcggcctatctcgcaggcctggcggttggcttctggcagaacctcgacgag
ctgcaagagaaagcggtgattgagcgcgagttccgtccaggcatcgaaaccactgagcgt
aattaccgttacgcaggctggaaaaaagcggtcaaacgcgcgatggcgtgggaagaacac
gacgagtaa

DBGET integrated database retrieval system