KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_23440Help
Entry
ECO55CA74_23440   CDS       T02066                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECO55CA74_23440
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECO55CA74_23440
   00620 Pyruvate metabolism
    ECO55CA74_23440
   00640 Propanoate metabolism
    ECO55CA74_23440
  Energy metabolism
   00680 Methane metabolism
    ECO55CA74_23440
Enzymes [BR:elr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ECO55CA74_23440
Lipid biosynthesis proteins [BR:elr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ECO55CA74_23440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4895777..4897735)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINAPDTFWGEQGKILDWIKPYQKVKNISF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRF
ANTLLKLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDQ
VEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDSYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgcacctgataccttctggggc
gaacagggaaaaattctcgactggatcaaaccgtaccagaaggtgaaaaacatctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgatcgtaccgccatcatctgggaaggcgac
gacgccagccagagcaaacatatcagctataaagagctgcaccgcgacgtctgccgcttc
gccaataccctgctcaagctgggcattaaaaaaggtgatgtggtggcgatttatatgccg
atggtgccggaagccgcggttgcgatgctggcctgcgcccgtattggcgcggtgcattcg
gtaattttcggtggcttctcgccggaagcggttgccgggcgcattatcgattccaactca
cgactggtgatcacttccgacgaaggcgtgcgcgccgggcgtagtattccgctgaagaaa
aacgttgatgacgcactaaaaaacccgaacgtcaccagcgtagagcatgtggtggtactg
aagcgtactggcgggaaaattgactggcaggaagggcgcgacctgtggtggcacgaccag
gttgagcaagccagcgatcagcaccaggcggaagagatgaacgccgaagatccgctgttt
attctctatacctccggttctaccggaaaaccaaaaggcgtactgcacactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggcgatatc
tactggtgcaccgccgatgtgggctgggtgaccggacacagttatttgctgtacggcccg
ctggcctgcggcgcgaccacgctgatgtttgaaggcgtaccgaactggccgacgcctgcc
cgtatggcacaggtggtggacaagcatcaggtcaatattctctataccgcgcccacggcg
attcgcgcgctgatggcggaaggcgataaagcgatcgaaggcaccgaccgttcgtcgctg
cgcattctcggttccgtgggcgagccaattaacccggaagcgtgggagtggtactggaaa
aaaatcggcaacgagaaatgtccggtggtcgatacctggtggcagaccgaaaccggcggt
ttcatgatcaccccgctgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtgcaaccggcgctggtcgataacgaaggtaacccgctggaaggggctacc
gaaggtagcctggtgatcaccgactcctggccgggtcaggcgcgtacgctgtttggcgat
cacgaacgttttgagcagacctatttttccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgtgatgaagatagctattactggatcaccgggcgtgtggacgatgtgctg
aacgtctccggtcaccgtctgggaacggcggagattgagtcggcgctggtggcgcatccg
aaaatcgccgaagccgctgtcgtcggtattccgcacaatattaaaggtcaggcgatctac
gcctacgtcacgcttaatcacggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtagtcgagaag
ctgcttgaagagaagcaggctatcgcgatgccatcgtaa

DBGET integrated database retrieval system