KEGG   Esox lucius (northern pike): 105025265Help
Entry
105025265         CDS       T04894                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase isoform X2
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
els  Esox lucius (northern pike)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:els00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    105025265 (mgll)
Enzymes [BR:els01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105025265 (mgll)
Peptidases [BR:els01002]
 Serine Peptidases
  Family S33
   105025265 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 302 aa AA seqDB search
MPEPEAALRTPQGVPYADLKHFVNADGQHLFSRYWEPDGPPRALVFVAHGAGEHSGLYGE
IGQTLKEQSLFVFAHDHVGHGQSEGDRMNIKDFQVFVRDSLQHIDLMKGRHPDLPVFIIG
HSMGGAISILTACERPNDFAGVVLIAPMVRMNPESATPFKVFLAKLANQIAPSLSLGSIK
SKWISRDQKQVEAYDADELNHHGGMRVSFATQLLTATEQIERQLPAITWPFLVLHGNADK
LCDITGSQMMFELAPSKDKKLKVYDGAYHALHHELPETAGSVLKELTGWISERLPAPPSQ
SS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagccagaagctgcgttgcggaccccgcaaggtgtcccatacgccgacctgaag
catttcgtaaacgccgacggacagcacttgttttcccgctactgggagccggatggcccc
ccaagggctctggtgtttgttgcccatggggcaggagagcattctgggctgtacggggag
attggccagaccctaaaggagcagtccctctttgtctttgcacacgaccatgttggtcac
ggccagagtgaaggagacaggatgaatattaaagacttccaggtgtttgtccgagactcc
cttcagcacattgacttgatgaagggacgacaccccgacctgcccgtcttcatcatcgga
cactctatgggcggtgccatctccattctgacggcgtgtgaacgaccaaacgactttgcc
ggcgtggttctgatcgcgcccatggtcagaatgaatccagaatctgccacgcccttcaag
gtgttcctggctaaattggccaaccagattgctccaagtctctcgctgggctccattaag
tcaaaatggatttcaagggaccaaaagcaggttgaggcgtatgacgctgacgagttgaac
caccatggggggatgcgggtttcgttcgccacccagctgcttaccgcgactgagcagatt
gagagacagctccccgccatcacctggcccttcctggttctccacggcaacgcggacaag
ctctgtgacatcacagggtcacagatgatgtttgagctggccccgagcaaggacaaaaag
ctcaaggtgtatgatggagcgtaccatgccctgcaccatgaactgcccgagacagcggga
tctgtactgaaggaactcaccggctggatctctgaacgtctcccggcacctccttcacag
agctcctag

DBGET integrated database retrieval system