KEGG   Esox lucius (northern pike): 105026566Help
Entry
105026566         CDS       T04894                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
els  Esox lucius (northern pike)
Brite
Enzymes [BR:els01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105026566
Peptidases [BR:els01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   105026566
Exosome [BR:els04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   105026566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 392 aa AA seqDB search
MRNRTGVRHSKEQRFGVKAGVPSAQPKSSSCLMWWIKRGLLAVCLIYVSVPFMMRLFPGI
IKHLVYSHRVRVPFFVELCQPAKLYLNHTVNMYLTSEQGISLGVWHTVPESQWKEAQGKN
LGWYQKSLGDGCPIVIYLHGNGGTRAASNRVGVMNVLSAMGYHVLALDYRGFGDSSGEPT
EVGLTTDALYLYHWVKARSGNSQVIFWGHSLGTGVATNTAVKLMEQGIVVDGVIIEGSFT
NIRQEGANHPFAWYYLNFPGFEYFFLDPMAENDLFFPNDENLKRMRSPLLILHAEDDHIV
PIHMAQQLYEIALTAQKSENRVKMIQFNGSLGYLHNGLYKDPHLPDIIRFLLEGLRTLYA
LNITYTQQLVSPCQQLMMSLFVFRGSNEWNVG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacaggactggagtccgtcactctaaagagcagaggtttggagtaaaagctggg
gtgccgagtgcacagccaaagtctagctcctgtttgatgtggtggattaaaagaggtctc
ctggctgtatgcctcatttatgtttcagtgcctttcatgatgcgactgttccctggcatc
ataaaacatcttgtatattctcatagagtcagggtcccattcttcgtcgaactttgccag
cctgccaaattgtatctaaaccatacagtgaacatgtaccttacctcagagcaaggaatc
tcactaggtgtatggcacacagttcctgaaagtcagtggaaagaggcacaaggaaagaac
ttgggatggtaccaaaagtctttaggagatggatgtccgattgtcatttatctccatggc
aatggaggcacaagggcggcaagtaatcgtgtaggagtaatgaatgtactcagtgcaatg
ggctaccatgttttggctttggactatagaggctttggggactccagcggggagcccact
gaagttggactaaccactgatgccctctacctgtaccactgggttaaagctcgcagtgga
aacagtcaggtgatattctggggacactcccttggcactggagtggccacaaacaccgca
gtcaaactaatggaacaagggattgtagttgatggtgtgatcattgaggggtcattcact
aacattcgacaggagggtgcgaatcatccttttgcctggtattatttgaacttccctggt
tttgagtactttttcctggacccaatggcagaaaatgatttatttttccctaatgatgag
aatttgaagaggatgaggagtccccttctgatccttcacgcagaggatgaccacattgtg
cccatccacatggctcagcagctgtatgaaatagcactgacagcccagaagtcagagaat
cgagtaaagatgatacaatttaatggatcccttggctaccttcataatgggttgtataaa
gaccctcacctgccagatatcatccgatttctgctagaaggccttcgtactttgtatgct
ttaaacattacgtatactcaacaacttgtctctccctgtcagcaactcatgatgtctcta
tttgtgttcaggggcagtaatgaatggaatgtcggctaa

DBGET integrated database retrieval system