KEGG   Escherichia coli UM146: UM146_01520Help
Entry
UM146_01520       CDS       T02000                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
elu  Escherichia coli UM146
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UM146_01520
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    UM146_01520
   00630 Glyoxylate and dicarboxylate metabolism
    UM146_01520
Enzymes [BR:elu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     UM146_01520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
315009..317180
Genome map
AA seq 723 aa AA seqDB search
MSQTITQGRLRIDANFKRFVDEEVLPGVELDAAAFWHNVDEIVHDLAPENRQLLAERDRI
QAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPDHVTVETTGIDSEITSQAGPQLVVP
AMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRGEQVIAWVRRFLDESLPL
ENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDTAAPTCILLKNNGLHIEL
QIDANGRIGKDDPAHINDVIVEAAISTILDCEDSVAAVDAEDKILLYRNLLGLMQGTLQE
KMEKNGRQIVRKLNDDRQYTAADGSEISLHGRSLLFIRNVGHLMTIPVIWDSEGNEIPEG
ILDGVMTGAIALYDLKVQKNSRTGSVYIVKPKMHGPQEVAFANKLFSRVETMLGMAPNTL
KMGIMDEERRTSLNLRSCIAQARNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMKSTP
WIKAYERNNVLSGLFCGLRGKAQIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTA
ATLHALHYHQTNVQSVQANIAQTEFNAEFEPLLDDLLTIPVAENANWSAQEIQQELDNNV
QGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATLRISSQHIANWLRHGILTKDQVQASL
ENMAKVVDQQNAGDPAYRPMVENFANSCAFKAACDLIFLGVKQPNGYTEPLLHAWRLREK
ENH
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaccataacccagggccgtttacgcattgacgccaattttaaacgttttgtg
gatgaagaagttttgcctggcgtggaactggatgctgccgcgttctggcacaatgttgat
gagatcgttcacgatctggcgccagagaatcgtcagttgctggcagagcgcgatcgcatt
caggcggcgcttgatgagtggcatcgcagcaatccggggccggtaaaagataaagcggcc
tataaatctttcctgcgtgaactgggctacctggtgccacagcctgaccacgttacggtg
gaaaccacgggcatcgacagcgaaatcaccagtcaggcggggccacagctggtggttccg
gcgatgaacgcccgctacgcgctgaacgcggcgaacgctcgctggggctcactgtacgat
gcgttatacggcagcgacatcatcccgcaggaaggggcgatggtcagcggctacgatccg
cagcgtggtgagcaggttatcgcctgggttcggcgtttcctcgatgaatcactaccgctg
gaaaatggcagctatcaggatgtggtggcgtttaaggtggtcgataaacaattacgcatc
cagttgaaaaatggtaaagaaaccacgttacgtactccagcacagtttgtcggttaccgt
ggcgatactgctgcgccgacctgcattttgctgaaaaataacggcctgcatattgagcta
caaatcgatgccaacgggcggattggcaaagacgatccggcgcacatcaacgatgttatc
gtcgaagcggccatcagtaccattctcgactgcgaagattcggttgcggcggttgatgcg
gaagataaaatcctgctgtaccgcaacctgctgggcctgatgcaggggactctgcaagag
aaaatggagaagaacggtcggcaaatcgtgcgtaaactgaatgacgatcgtcagtacact
gccgccgatggatctgaaatttctctgcacggacgctcgttgctgtttatccgcaacgtg
ggtcatttgatgaccattcctgtgatttgggacagcgaaggcaatgaaatcccggaaggc
attcttgatggtgtcatgactggcgcgattgccctctatgatttaaaagtgcagaaaaac
tcgcgcactggcagcgtctatattgtgaaaccgaaaatgcacggtccgcaggaagtggcg
ttcgccaacaaactgttttcccgcgttgagacaatgctcggtatggcaccgaataccctg
aaaatgggcattatggatgaagaacgccggacctcgctgaacttgcgtagctgtatcgct
caggcgcgcaaccgcgtggcgttcatcaataccggtttcctcgaccgtaccggcgatgaa
atgcattcggtgatggaagcgggcccgatgctgcgtaaaaaccagatgaaatcgacgccg
tggatcaaagcctacgaacgtaataacgtgctttccggtctgttctgtgggctacgtgga
aaagcgcaaatcggtaaaggcatgtgggcaatgccggacctgatggcagacatgtacagc
cagaagggcgaccaattgcgtgccggggcaaacacggcctgggttccgtcgccaactgcc
gctacgctccatgcgctgcactaccaccaaaccaacgtacagagcgtgcaagccaacatt
gcccagaccgagttcaatgctgaatttgaaccgctgctggacgatctgctgactattccg
gttgctgaaaacgctaactggtcggcgcaagagatccaacaagagctggataacaacgtg
caggggattctggggtacgtggtgcgttgggtggagcaggggattggttgttcaaaagtg
ccggatattcacaacgtggcgttgatggaagaccgcgcaacgctgcgtatttccagccag
catatcgccaactggttacgtcacggtattctgaccaaagatcaggtgcaggcgtcgctg
gagaatatggcgaaagtggttgatcagcaaaacgctggcgatccggcttatcgtccaatg
gtggagaatttcgctaactcgtgtgcttttaaagctgcctgcgatttgatcttcctcggc
gtgaaacagccaaacggctataccgaaccgttattacacgcatggcgtttacgcgaaaaa
gaaaatcattaa

DBGET integrated database retrieval system