KEGG   Escherichia coli UM146: UM146_06585Help
Entry
UM146_06585       CDS       T02000                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalF (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
elu  Escherichia coli UM146
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    UM146_06585
   00052 Galactose metabolism
    UM146_06585
   00500 Starch and sucrose metabolism
    UM146_06585
   00520 Amino sugar and nucleotide sugar metabolism
    UM146_06585
Enzymes [BR:elu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     UM146_06585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1391008..1391901
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQAVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatc
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactgctggcggaagtacagtccatttgcccgccgggcgtgacaattatg
aacgtgcgtcagggcgaacctttaggtttgggccactccattttatgtgcacgacctgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgctgcgctacaaccttgctgccatgattgcgcgctttaacgaaactggccgcagc
caggttctggcaaaacgcatgccgggcgatctctctgaatactccgtcatccagactaaa
gaaccgcttgatcgcgaaggtaaagtcagccgcattgttgaatttatcgaaaaaccggat
cagccgcagaccctggactcagacatcatggctgtagggcgttatgtgctttctgccgat
atttggcctgaactggagcgtactcaacctggagcatggggacgtattcagttgactgat
gccattgctgagttggcaaaaaaacaagcagttgacgcaatgctgatgactggggacagt
tacgactgcggaaagaaaatgggttatatgcaagcgtttgtgaagtatgggctgcgtaac
ctaaaagaaggggcgaagttccgtaaagggattgagaagctgttaagcgaataa

DBGET integrated database retrieval system