KEGG   Escherichia coli UM146: UM146_07460Help
Entry
UM146_07460       CDS       T02000                                 

Gene name
fliM
Definition
(GenBank) flagellar motor switch protein FliM
  KO
K02416  flagellar motor switch protein FliM
Organism
elu  Escherichia coli UM146
Pathway
elu02030  Bacterial chemotaxis
elu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:elu00001]
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    UM146_07460 (fliM)
   02040 Flagellar assembly
    UM146_07460 (fliM)
Bacterial motility proteins [BR:elu02035]
 Flagellar system
  Flagellar assembly proteins
   C-ring
    UM146_07460 (fliM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliM FliMN_C
Motif
Other DBs
NCBI-ProteinID: ADN70883
Position
complement(1596105..1597109)
Genome map
AA seq 334 aa AA seqDB search
MGDSILSQAEIDALLNGDSEVKDEPTASVSGESDIRPYDPNTQRRVVRERLQALEIINER
FARHFRMGLFNLLRRSPDITVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSP
SLVFIAVDNLFGGDGRFPTKVEGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYV
RSEMQVKFTNITTSPNDIVVNTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSR
NEDQNWRDNLVRQVQHSQLELVANFADISLRLSQILKLKPGDVLPIEKPDRIIAHVDGVP
VLTSQYGTLNGQYALRIEHLINPILNSLNEEQPK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatagtattctttctcaagctgaaattgatgcgctgttgaatggcgacagcgaa
gtcaaagacgaaccgacagccagtgttagcggcgaaagtgacattcgtccgtacgatccg
aatacccaacgacgggttgtgcgcgaacgtttgcaggcgctggaaatcattaatgagcgc
tttgctcgccattttcgtatggggctgttcaacctgctgcgccgtagcccggatattacc
gtcggggccatccgcattcagccgtaccatgaatttgcccgcaacctgccggtgccgacc
aacctgaaccttattcatctgaaaccgctgcgcggcacagggctggtggtgttctcgccg
agtctggtgtttatcgccgtggataacctgtttggcggcgatggacgcttcccgaccaaa
gtggaaggccgcgagtttacccataccgaacagcgcgtcatcaaccgcatgttgaaactg
gcgcttgaaggctatagcgacgcatggaaggcgattaatccgctggaagttgagtacgtg
cgttcggaaatgcaggtgaaatttaccaatatcaccacctcgccaaacgacattgtggtt
aacacgccgttccatgtggagattggcaacctgaccggcgaatttaatatctgcctgcca
ttcagcatgatcgagccgctacgggaattgttggttaacccgccgctggaaaactcgcgt
aatgaagatcagaactggcgcgataacctggtgcgccaggtgcagcattcacagctggaa
ctggtggccaactttgccgatatctcgctacgcctgtcgcagattttaaaactgaaaccc
ggcgacgtcctgccgatagaaaaacccgatcgcatcatcgcccatgttgacggcgtcccg
gttctgaccagtcagtacggcactctcaacggtcagtatgcgttacggatagaacatttg
attaacccgattttaaattctctgaacgaggaacagcccaaatga

DBGET integrated database retrieval system