KEGG   Escherichia coli UM146: UM146_07495Help
Entry
UM146_07495       CDS       T02000                                 

Gene name
fliF
Definition
(GenBank) flagellar MS-ring protein
  KO
K02409  flagellar M-ring protein FliF
Organism
elu  Escherichia coli UM146
Pathway
elu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:elu00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    UM146_07495 (fliF)
Secretion system [BR:elu02044]
 Type III secretion system
  Flagellar export apparatus
   UM146_07495 (fliF)
Bacterial motility proteins [BR:elu02035]
 Flagellar system
  Flagellar assembly proteins
   M,S,P and L rings
    UM146_07495 (fliF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YscJ_FliF YscJ_FliF_C Mt_ATP-synt_B
Motif
Other DBs
NCBI-ProteinID: ADN70890
Position
complement(1602309..1603967)
Genome map
AA seq 552 aa AA seqDB search
MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEALTREAMGFSEKRGD
SLNVVNSPFNSSDESGGALPFWQQQVFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
EAVKTVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
LVIRQWINNDHE
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgactgcagcccagacaaaatctcttgagtggcttaatcgcctgcgtgcgaat
ccgaaaattccattgattgttgccggttccgcagcagtggcggtcatggtcgcactgatc
ctgtgggcgaaagcccccgactaccgcacattattcagcaatctttccgatcaggatggt
ggcgcaattgtcagccaactgacgcaaatgaatattccttaccgcttcagcgaagccagc
ggcgctattgaggttccggcagataaagttcacgaactgcgcctgcgcctggcgcaacaa
ggtttgcccaaaggcggcgcggtcggtttcgaactgctcgatcaggaaaagtttggtatc
agccagttcagcgaacaggtgaattatcagcgggcgctggaaggcgagctttctcgtacc
atcgaaactatcggcccggtaaaaggggcgcgcgtacatctggcaatgccgaaaccgtct
ttattcgtccgtgaacaaaaatccccttctgcatcggtgacggtaaatctgttacccggc
cgcgcactcgatgaagggcaaattagcgctattgtacatctggtttccagcgcggttgct
ggtctgccgccaggaaacgtcacgctggtggatcagggcgggcatctgttaacccagtcc
aataccagcgggcgcgatcttaatgacgctcagttgaaatatgccagcgatgtcgaaggc
cgtattcagcggcgtattgaagcgatcctgtcgcctattgttggtaacggtaatattcac
gcccaggtcacggcgcaactggacttcgccagtaaagaacaaacggaagaacagtatcgc
cctaacggtgatgaatctcatgcggcgcttcgttcacgccagcttaatgagagcgagcaa
agcggttccggttatccgggcggcgtaccgggagcgttgtcgaatcaaccggcacctgcg
aataacgcgccaatcagcacgcctccggcaaatcaaaataaccgccagcagcaggcgagc
accaccagcaatagtgggccgcgtagcacacagcggaatgaaaccagtaactacgaagtc
gatcgcaccattcgtcataccaaaatgaacgtgggcgatgtgcaacgtctgtcagtcgcg
gtagtggtgaattacaaaaccttgccagacggtaaaccattgcctctcagcaacgaacag
atgaagcaaattgaagctctgacccgcgaggcgatgggcttttctgaaaaacgcggtgat
tcgctcaatgttgttaactcgccgttcaatagcagtgacgaaagcggcggagcactgccg
ttctggcaacagcaagtgtttatcgatcagttgctggctgccggtcgctggttgctggta
ctgctggtggcgtggttgctgtggcggaaagcggtacgcccgcagctaacacgtcgcgcc
gaggcggtgaagactgtgcagcaacaggcgcaggcccgcgaggaagtggaagatgcggtg
gaagtccgtctgagcaaagacgaacaactccaacaacggcgcgctaaccaacgactgggg
gcagaagtcatgagccagcgtatccgtgaaatgtctgataacgatccgcgcgtggtggcg
ctggtcattcgccagtggataaataacgatcatgagtaa

DBGET integrated database retrieval system