KEGG   Escherichia coli UM146: UM146_07625Help
Entry
UM146_07625       CDS       T02000                                 

Definition
(GenBank) hypothetical protein
  KO
K07039  uncharacterized protein
Organism
elu  Escherichia coli UM146
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0149 SEC-C
Motif
Other DBs
NCBI-ProteinID: ADN70916
Position
1627923..1628588
Genome map
AA seq 221 aa AA seqDB search
MKTGPLNESELEWLDDILTKYNTDHAILDVAELDGLLTAVLSSPQEIEPAQWLVAVWGGA
DYVPRWASEKEMTRFMNLAFQHMADTAERLNEFPEQFEPLFGLREVDGSELTIVEEWCFG
YMRGVALSDWSTLPDSLKPALEAIALHGTEENFERVEKMSPEAFEESVDAIRLAALDLHA
YWMAHPQEKAVQQPIKAEEKPGRNDPCPCGSGKKFKQCCLH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgggaccgttaaacgaaagtgagttggaatggctggacgatattctgaccaaa
tacaacactgaccacgccattcttgatgtggcggagctggacggtttattgacggcggtg
ttgagttctccgcaagagattgaaccggcacagtggctggttgccgtgtggggtggggct
gactatgtgccgcgctgggcgtcagagaaagagatgacgcgctttatgaacctggctttt
caacatatggccgataccgcagagcgtctgaacgaattcccggagcagtttgagccgtta
ttcggcttgcgagaagtcgatggcagcgagctgacgattgttgaggagtggtgctttggc
tatatgcggggcgtggcactttctgactggtcaacgttgcccgattcgttaaaaccagcg
ctggaggcgattgcgctgcacggtactgaggaaaacttcgagcgggtagagaagatgtcg
ccagaagcgtttgaagagagcgtagatgctattcggctggcggcgcttgatttacatgca
tactggatggcgcatccgcaggaaaaagctgttcagcaaccgatcaaagcagaagagaaa
ccggggcgtaacgatccttgtccgtgtggcagtggtaagaaatttaagcagtgctgcctg
cattaa

DBGET integrated database retrieval system