KEGG   Escherichia coli UM146: UM146_07665Help
Entry
UM146_07665       CDS       T02000                                 

Definition
(GenBank) L-arabinose-binding periplasmic protein precursor
  KO
K10537  L-arabinose transport system substrate-binding protein
Organism
elu  Escherichia coli UM146
Pathway
elu02010  ABC transporters
Module
elu_M00213  L-Arabinose transport system
Brite
KEGG Orthology (KO) [BR:elu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    UM146_07665
Transporters [BR:elu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   L-Arabinose transporter [MD:M00213] [OT]
    UM146_07665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_1 Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: ADN70924
Structure
PDB: 

Jmol
Position
1633403..1634392
Genome map
AA seq 329 aa AA seqDB search
MHKFTKALAAIGLAAVMSQSAMAENLKLGFLVKQPEEPWFQTEWKFADKAGKDLGFEVIK
IAVPDGEKTLNAIDSLAASGAKGFVICTPDPKLGSAIVAKARGYDMKVIAVDDQFVNAKG
KPMDTVPLVMMAATKIGERQGQELYKEMQKRGWDVKESAVMAITSNELDTARRRTTGSMD
ALKAAGFPEKQIYQVPTKSNDIPGAFDAANSMLVQHPEVKHWLIVGMNDSTVLGGVRATE
GQGFKASDIIGIGINGVDAVSELSKAQATGFYGSLLPSPDVHGYKSSEMLYNWVAKGVEP
TKFTEVTDVVLITRDNFKEELEKKGLGGK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaatttactaaagccctggcagccattggtctggcagccgttatgtcacaatcc
gctatggcggagaacctgaagctcggtttcctggtgaagcaaccggaagagccgtggttc
cagaccgaatggaagtttgccgataaagccgggaaggatttagggtttgaagttattaag
attgccgtgccggatggcgaaaaaacattgaacgctatcgacagcctggctgccagtggc
gcgaaaggtttcgttatttgtactccggacccgaaactcggctctgccatcgtggcgaaa
gcgcgtggctacgatatgaaagtcattgccgtggatgaccagtttgttaacgccaaaggt
aagccaatggataccgttccgctggtgatgatggctgcgaccaaaattggcgaacgtcag
ggccaggaactgtataaagagatgcagaaacgtggctgggatgtcaaagaaagcgcggtg
atggcgattacctccaacgaactggatacggctcgtcgccgtactacggggtctatggat
gcgctgaaagctgcaggattcccggaaaaacaaatttatcaggtacctaccaaatctaac
gacatcccgggggcatttgacgctgccaactcaatgctggttcaacatccggaagttaaa
cattggctgattgtcggtatgaacgacagcaccgtgctgggcggcgtacgcgcgacggaa
ggtcagggctttaaagcgagcgatatcatcggtatcggtattaacggtgtggatgcggtg
agtgaactgtctaaggcacaggcaaccggcttctacggttccctgctgccaagcccggac
gtacatggttataagtccagcgaaatgctttacaactgggttgcaaaaggtgttgaaccg
accaaattcaccgaagttaccgacgtggtgctgatcacgcgtgacaactttaaagaagaa
ctggagaaaaaaggtttaggcggtaagtaa

DBGET integrated database retrieval system