KEGG   Escherichia coli UM146: UM146_07735Help
Entry
UM146_07735       CDS       T02000                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
elu  Escherichia coli UM146
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:elu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:elu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1648878..1649927
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAAKASLAAHKPLSVPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELARSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAKQAGRNAVGVILTGMGNDGAAGMLAMRQAGAW
TLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcagggtgttatctgtcgatgattcggcactgatgcgccagatcatgaca
gaaatcatcaacagccatagcgacatggaaatggtggcgaccgcccctgatccgctggtt
gcgcgtgatttgattaagaaattcaatcccgatgtattgacgctggatgttgaaatgccg
cggatggacggactggatttcctcgaaaaattaatgcgtttgcgtccaatgcccgttgtg
atggtttcttccctgaccggcaaagggtcagaagttacgctgcgcgcgctggagctgggg
gcgatagattttgtcaccaaaccgcaactgggtattcgcgaaggaatgctggcatatagc
gaaatgattgctgaaaaggtgcgtacggcagcaaaggcgagccttgcagcacataagcca
ttgtcggtaccgacaacgctgaaggcggggccgttgttgagttctgaaaaactgattgcg
attggtgcttcaacgggtggaactgaggcaattcgtcacgtactgcaaccgttgccgctt
tccagtccggcactgttaattacccagcatatgccgcccggtttcacccgctcttttgcc
gacagacttaataagctttgccagatcggggttaaagaagccgaagacggagagcgcgtc
ttgccgggacatgcctatatcgcgccgggcgatcggcatatggagctggcgcgtagtggc
gcaaattatcaaatcaaaattcacgatggccctgcggttaatcgccatcggccatcggta
gatgtgttgttccattctgtggccaaacaggcggggcgtaatgcggttggggtaatccta
accggtatgggcaacgacggcgcggcgggaatgttggcgatgcgtcaggcgggggcatgg
acccttgcgcaaaacgaagcaagttgcgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggtgtctgcgaagtggtcgatcttagccaggtaagtcagcaaatgctggcaaaa
attagtgccggacaggcgatacgtatttaa

DBGET integrated database retrieval system