KEGG   Escherichia coli UM146: UM146_07820Help
Entry
UM146_07820       CDS       T02000                                 

Gene name
aspS
Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
elu  Escherichia coli UM146
Pathway
elu00970  Aminoacyl-tRNA biosynthesis
Module
elu_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:elu00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    UM146_07820 (aspS)
Enzymes [BR:elu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     UM146_07820 (aspS)
Amino acid related enzymes [BR:elu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   UM146_07820 (aspS)
Transfer RNA biogenesis [BR:elu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    UM146_07820 (aspS)
 Prokaryotic Type
   Other AARSs
    UM146_07820 (aspS)
Mitochondrial biogenesis [BR:elu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    UM146_07820 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: ADN70955
Structure
PDB: 

Jmol
Position
1666130..1667902
Genome map
AA seq 590 aa AA seqDB search
MRTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDRADALKLA
SELRNEFCIQVTGTVRARDEKNINRDMATGEIEVLASSLTIINRADVLPLDSNHVNTEEA
RLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPS
RVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMT
APQVREVMEALVRHLWLEVKGVDLGDFPVMTFAEAERRYGSDKPDLRNPMELTDVADLLK
SVEFAVFAGPANDPKGRVAALRVPGGASLTRKQIDEYGNFVKIYGAKGLAYIKVNERAKG
LEGINSPVAKFLNAEIIEAILERTGAQDGDMIFFGADNKKIVADAMGALRLKVGKDLGLT
DESKWAPLWVIDFPMFEDDGEGGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVING
YEVGGGSVRIHNGDMQQTVFGILGINEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTM
LLTGTDNIRDVIAFPKTTAAACLMTEAPSFANPTALAELSIQVVKKAENN
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacagaatattgtggacagctccgtttgtcccacgtggggcagcaggtgactctg
tgtggttgggtcaaccgtcgtcgtgatcttggtagcctgatcttcatcgatatgcgcgac
cgcgaaggtatcgtgcaggtatttttcgatccggatcgtgcggacgcgttaaagctggcc
tctgaactgcgtaatgagttctgcattcaggtcacgggcaccgtacgtgcgcgtgacgaa
aaaaatattaaccgcgatatggcgactggcgaaatcgaagtactggcgtcctcgctgact
atcatcaatcgtgcagatgttctgccgcttgactctaaccacgtcaacaccgaagaagcg
cgtctgaaataccgctacctcgacctgcgtcgcccggaaatggctcagcgcctgaaaacc
cgcgctaaaatcaccagcctggtgcgccgttttatggatgaccacggcttcctcgacatc
gaaactccgatgctgaccaaagccacgccggaaggcgcgcgtgactacctggtgccttct
cgtgtgcacaaaggtaaattctacgcgctgccgcaatccccgcagttgttcaaacagcta
ctgatgatgtccggctttgaccgctactatcagatcgttaaatgcttccgtgacgaagac
ctgcgtgctgaccgtcagcctgaatttactcagatcgatgtggaaacttctttcatgacc
gcgccgcaagtgcgtgaagtgatggaagcgctggtgcgtcatctgtggctggaagtgaag
ggcgtggatctgggcgatttcccggtaatgacctttgcagaagcagaacgccgttatggt
tctgataaaccggatctgcgtaacccgatggaactgaccgacgttgccgatctgctgaaa
tctgttgagtttgcagtatttgcaggtccggcgaacgatccgaaaggccgtgttgccgct
ctgcgtgttccgggcggcgcatcgttgacccgtaagcagatcgacgaatacggtaacttc
gttaaaatctacggcgcgaaaggtctggcttacatcaaagttaacgaacgcgcgaaaggt
ctggaaggtatcaatagcccggtagcgaagttccttaatgcagaaatcatcgaagccatc
ctggagcgtactggcgcgcaagatggcgatatgattttcttcggtgccgacaacaagaaa
attgttgccgacgcgatgggcgcactgcgcctgaaagtgggtaaagaccttggtctgacc
gacgaaagcaaatgggcaccgctgtgggttatcgacttcccgatgtttgaagacgacggt
gaaggcggcctgacagcaatgcaccatccgttcacctcaccgaaagacatgacggcagca
gaactgaaagctgcaccggaaaatgcggtggctaacgcttacgatatggtcatcaatggt
tacgaagtgggcggtggttctgtgcgtatccataatggtgatatgcagcagacggtgttt
ggtattctgggtatcaacgaagaggaacagcgcgagaaattcggcttcctgctcgacgcc
ctgaaatacggtactccgccgcacgcaggtctggcattcggtcttgaccgtctgacgatg
ctgctgaccggcaccgacaatatccgtgacgttatcgccttcccgaaaaccacggcggca
gcgtgtctgatgactgaagcaccgagctttgctaacccgactgcactggctgagctgagc
attcaggttgtgaagaaggctgagaataactga

DBGET integrated database retrieval system