KEGG   Escherichia coli UM146: UM146_07880Help
Entry
UM146_07880       CDS       T02000                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
elu  Escherichia coli UM146
Pathway
elu00010  Glycolysis / Gluconeogenesis
elu00230  Purine metabolism
elu00620  Pyruvate metabolism
elu01100  Metabolic pathways
elu01110  Biosynthesis of secondary metabolites
elu01120  Microbial metabolism in diverse environments
elu01130  Biosynthesis of antibiotics
elu01200  Carbon metabolism
elu01230  Biosynthesis of amino acids
Module
elu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
elu_M00002  Glycolysis, core module involving three-carbon compounds
elu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
elu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UM146_07880
   00620 Pyruvate metabolism
    UM146_07880
  Nucleotide metabolism
   00230 Purine metabolism
    UM146_07880
Enzymes [BR:elu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     UM146_07880
Membrane trafficking [BR:elu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    UM146_07880
Exosome [BR:elu04147]
 Exosomal proteins
  Proteins found in most exosomes
   UM146_07880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C
Motif
Other DBs
NCBI-ProteinID: ADN70967
Position
complement(1677506..1678948)
Genome map
AA seq 480 aa AA seqDB search
MSRRLRRTKIVTTLGPATDRDNNLEKVIAAGANVVRMNFSHGSPEDHKMRADKVREIAAK
LGRHVAILGDLQGPKIRVSTFKEGKVFLNIGDKFLLDANLGKGEGDKEKVGIDYKGLPAD
VVPGDILLLDDGRVQLKVLEVQGMKVFTEVTVGGPLSNNKGINKLGGGLSAEALTEKDKA
DIKTAALIGVDYLAVSFPRCGEDLNYARRLARDAGCDAKIVAKVERAEAVCSQEAMDDII
LASDVVMVARGDLGVEIGDPELVGIQKALIRRARQLNRAVITATQMMESMITNPMPTRAE
VMDVANAVLDGTDAVMLSAETAAGQYPSETVAAMARVCLGAEKIPSINVSKHRLDVQFDN
VEEAIAMSAMYAANHLKGVTAIITMTESGRTALMTSRISSGLPIFAMSRHERTLNLTALY
RGVTPVHFDSANDGVAAASEAVNLLRDKGYLMSGDLVIVTQGDVMSTVGSTNTTRILTVE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaggcttcgcagaactaaaatcgttaccacgttaggcccggcaacagatcgc
gataataaccttgaaaaagttatcgcggcgggtgccaacgttgtacgtatgaatttttct
cacggctcgcctgaagatcacaaaatgcgcgcggataaagttcgtgagattgccgcaaaa
ctggggcgtcatgtggctattctgggtgacctccaggggcccaaaatccgtgtatccacc
tttaaagaaggcaaagttttcctcaatattggggataaattcctgctcgacgccaacctg
ggtaaaggtgaaggcgacaaagaaaaagtcggtatcgactacaaaggcctgcctgctgac
gttgtgcctggtgacatcctgctgctggacgatggtcgcgtccagttaaaagtactggaa
gtccagggcatgaaagtgttcaccgaagtgaccgtcggtggtcccctctccaacaataaa
ggtatcaacaaacttggcggcggtttgtcggctgaagcgctgaccgaaaaagacaaagca
gacattaagactgcggcgttaattggcgtagattacctggctgtctccttcccacgctgc
ggcgaagatctgaactatgcccgtcgcctggcacgcgatgcaggatgtgatgcgaaaatt
gttgccaaggttgaacgtgcggaagccgtttgcagccaggaggcaatggatgacatcatc
ctcgcctctgacgtggtaatggttgctcgcggcgacctcggtgtggaaattggcgatccg
gaactggtcggcattcagaaagcgttgatccgtcgtgcgcgtcagcttaaccgcgcggta
atcactgcgacccagatgatggagtcaatgattactaacccgatgccgacgcgtgcagaa
gtcatggacgtagcaaacgccgttctggatggtactgacgctgtgatgctgtcggcagaa
actgctgctggtcaatacccgtcagaaactgttgcagccatggcgcgcgtttgcctgggg
gcggaaaaaatcccgagcatcaacgtttctaaacaccgtctggacgttcagttcgacaat
gtggaagaagctattgccatgtcagcaatgtacgcggctaaccacctgaaaggcgttacg
gcgatcatcaccatgaccgaatcgggtcgtaccgcgctgatgacctcccgtatcagctct
ggtctgccaattttcgccatgtcacgccatgaacgtacgctgaacctgactgctctctat
cgcggcgttacgccggtgcactttgatagcgctaatgacggcgtagcggctgccagcgaa
gcggttaatctgctgcgcgataaaggttacttgatgtctggtgacctggtgattgtcacc
cagggcgacgtgatgagtaccgtgggttctactaataccacgcgtattttaacggtagag
taa

DBGET integrated database retrieval system