KEGG   Escherichia coli UM146: UM146_07995Help
Entry
UM146_07995       CDS       T02000                                 

Definition
(GenBank) mce-related protein
Organism
elu  Escherichia coli UM146
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MlaD
Motif
Other DBs
NCBI-ProteinID: ADN70990
Position
complement(1696452..1699085)
Genome map
AA seq 877 aa AA seqDB search
MSQETPASTTEAQIKNKRRISPFWLLPFIALMIAGWLIWDSYQDRGNTVTIDFMSADGIV
PGRTPVRYQGVEVGTVQDISLSDDLRKIEVKVSIKSDMKDALREETQFWLVTPKASLAGV
SGLDALVGGNYIGMMPGKGKEQDHFVALDTQPKYRLDNGDLMIHLQAPDLGSLSSGSLVY
FRKIPVGKVYDYAINPNKQGVVIDVLIERRFTDLVKKGSRFWNVSGVDANVSISGAKVKL
ESLAALVNGAIAFDSPEESKPAEAEDTFGLYEDLAHSQRGVIIKLELPGGAGLTADSTPL
MYQGLEVGQLTKLDLNPGGKVTGEMTVDPSVVTLLRKNTRIELRNPKLSLSDANLSALLT
GKTFELVPGDGEPRKEFVVVPGEKALLQEPDVLTLTLTAPESYGIDAGQPLILHGVQVGQ
VIDRKLTSKGVTFTVAIEPQHRELVKGDSKFVVNSRVDVKVGLDGVEFLGASASEWINGG
IRILPGDKGEMKASYPLYANLEKALENSLSDLPTTTVSLSAETLPDVQAGSVVLYRKFEV
GEVITVRPRANAFDIDLHIKPEYRNLLTSNSVFWAEGGAKVQLNGSGLTVQASPLSRALK
GAISFDNLSGASASQRKGDKRILYASETAARAVGGQITLHAFDAGKLAVGMPIRYLGIDI
GQIQTLDLITARNEVQAKAVLYPEYVQTFARGGTRFSVVTPQISAAGVEHLDTILQPYIN
VEPGRGNPRRDFELQEATITDSRYLDGLSIIVEAPEAGSLGIGTPVLFRGLEVGTVTGMT
LGTLSDRVMIAMRISKRYQHLVRNNSVFWLASGYSLDFGLTGGVVKTGTFNQFIRGGIAF
ATPPGTPLAPKAQEGKHFLLQESEPKEWREWGTALPK
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggaaacgcccgcttcgacgactgaagcgcagattaaaaataaacgccgtatc
tcacctttctggctgctgccgttcatcgcgctaatgattgctggttggctgatttgggac
agttatcaggaccggggtaataccgtcaccatcgactttatgtcggcggatggtattgtt
ccaggccgtacgcctgttcgttatcagggcgttgaagttggaacagtgcaggatatcagc
ctcagcgacgatcttcgtaagattgaagtcaaggtcagcatcaagtccgatatgaaagat
gcgctgcgcgaagagacacagttctggctggtgacgccaaaggcctcgttggcaggtgtc
tccgggctggacgccctcgtcggtggtaattatatcggcatgatgccgggtaaaggtaaa
gagcaggatcactttgtcgcactcgacacccaaccgaaatatcggctggacaatggcgat
ctgatgatccacctgcaagcccccgatctcggttcactgagcagtggttcattggtctat
ttccgcaagatcccggtgggtaaagtctacgactatgccatcaatcccaacaagcaaggc
gtggtgattgatgtcctgatcgagcggcgttttaccgatctggtgaaaaaaggtagccgt
ttctggaacgtttccggcgttgatgccaacgtcagtatcagtggcgcgaaggtgaaactg
gaaagtctggcggcactggttaacggtgcgattgccttcgattcacctgaagagtcgaaa
cctgccgaagcggaagatacctttggtctgtatgaagacctggcccatagccaacgtggc
gtaataataaaactggaactgccaggcggtgccggattaaccgccgactcgacgccgtta
atgtatcaggggctggaagtcggacagctgactaaactggatttaaatcctggtggtaaa
gtcactggggaaatgaccgttgatcccagcgtcgtcaccctgcttcgtaaaaatacccgc
atcgaattacgtaatccgaaattatcccttagcgatgctaatctcagtgccctgctgacc
ggcaaaaccttcgaactggtgcccggcgatggcgagccacgtaaagagttcgtggttgtg
ccaggcgaaaaagccctgctgcaagagccggatgttctgacactgaccctgacagcacca
gaaagttacggtattgatgctggtcagccgctcattcttcacggcgtgcaggtaggccag
gttatcgatcgtaaactcaccagcaaaggcgtcacctttaccgtcgccatcgagcctcag
catcgcgaactggtaaaaggcgatagcaaatttgtcgtcaacagccgcgtcgacgtgaag
gtagggctggatggcgttgagtttctcggtgccagcgcctcagaatggatcaatggcgga
atacgtattctgccgggcgataaaggcgagatgaaagccagctatccactgtatgccaat
ctggaaaaagcgctggagaacagccttagcgatttacccaccacaaccgtgagtttgagt
gcagagacgctgccggatgtgcaggcaggatcggtagtgctgtaccgtaaatttgaagtt
ggtgaagttattactgtgcgtccgcgagctaacgcgtttgatatcgatctgcatattaag
ccggagtatcgcaaccttctgaccagcaacagcgtgttctgggcagaaggtggggcgaaa
gttcagctgaatggtagtggtctgactgtacaggcatccccgctctccagagcattaaag
ggggctattagcttcgataacctcagcggtgccagcgccagtcagcgtaaaggcgacaag
cgtattctgtatgcttccgaaacagcggcccgtgcggttggcggacaaattacgcttcac
gctttcgatgcgggaaaactggcggtcgggatgccaattcgctatctcggtattgatatc
gggcaaatccagacgctggatctgattaccgcacgcaatgaagtacaggcaaaggcggtg
ctctatccggaatatgtccagacctttgctcgcggtggtacgcgcttctcagtggtcaca
ccgcaaatttcggcagctggcgttgagcatcttgatactatcctccagccgtatatcaac
gtcgaaccaggccggggcaatcctcgccgcgactttgaattacaagaggccaccattact
gattcgcgttacctggatggcttaagcattattgttgaagcgccggaagccggttcgtta
ggtatcggtacacctgtgctgttccgtggtctggaagtaggtacggttaccggaatgacg
ctggggacattgtcagatcgcgtgatgattgcgatgcgcatcagtaaacgctatcaacac
ctggtgcgtaacaattccgtcttctggttggcatcgggttacagtctggactttggtctg
acgggcggcgtagtgaaaaccggcacctttaaccagtttatccgtggcggcatcgccttc
gccacgcctccgggtacgccactggcaccgaaagcccaggaaggcaagcacttcctgttg
caggaaagtgaaccgaaagagtggcgtgaatggggaactgcgcttcccaaataa

DBGET integrated database retrieval system